+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9d39 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Gly-,PPDA- bound GluN1a-2B-2D NMDAR | ||||||||||||||||||||||||
Components | (Glutamate receptor ionotropic, NMDA ...) x 3 | ||||||||||||||||||||||||
Keywords | MEMBRANE PROTEIN / NMDAR / PPDA-bound | ||||||||||||||||||||||||
| Function / homology | Function and homology informationregulation of sensory perception of pain / glycine-gated cation channel activity / excitatory chemical synaptic transmission / Activated NTRK2 signals through FYN / Synaptic adhesion-like molecules / cellular response to L-glutamate / propylene metabolic process / response to glycine / negative regulation of dendritic spine maintenance / neurotransmitter receptor complex ...regulation of sensory perception of pain / glycine-gated cation channel activity / excitatory chemical synaptic transmission / Activated NTRK2 signals through FYN / Synaptic adhesion-like molecules / cellular response to L-glutamate / propylene metabolic process / response to glycine / negative regulation of dendritic spine maintenance / neurotransmitter receptor complex / Assembly and cell surface presentation of NMDA receptors / regulation of monoatomic cation transmembrane transport / Neurexins and neuroligins / NMDA glutamate receptor activity / voltage-gated monoatomic cation channel activity / NMDA selective glutamate receptor complex / glutamate binding / ligand-gated sodium channel activity / glutamate receptor signaling pathway / calcium ion transmembrane import into cytosol / protein heterotetramerization / glycine binding / startle response / positive regulation of reactive oxygen species biosynthetic process / Negative regulation of NMDA receptor-mediated neuronal transmission / Unblocking of NMDA receptors, glutamate binding and activation / monoatomic cation transmembrane transport / Long-term potentiation / positive regulation of calcium ion transport into cytosol / regulation of neuronal synaptic plasticity / monoatomic cation transport / ligand-gated monoatomic ion channel activity / synaptic cleft / calcium ion homeostasis / MECP2 regulates neuronal receptors and channels / positive regulation of synaptic transmission, glutamatergic / glutamate-gated receptor activity / EPHB-mediated forward signaling / glutamate-gated calcium ion channel activity / presynaptic active zone membrane / excitatory synapse / ionotropic glutamate receptor signaling pathway / Ras activation upon Ca2+ influx through NMDA receptor / ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential / positive regulation of excitatory postsynaptic potential / hippocampal mossy fiber to CA3 synapse / sodium ion transmembrane transport / synaptic membrane / adult locomotory behavior / synaptic transmission, glutamatergic / excitatory postsynaptic potential / regulation of membrane potential / transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential / brain development / regulation of synaptic plasticity / visual learning / postsynaptic density membrane / calcium ion transmembrane transport / terminal bouton / synaptic vesicle / late endosome / long-term synaptic potentiation / amyloid-beta binding / RAF/MAP kinase cascade / signaling receptor activity / dendritic spine / chemical synaptic transmission / cytoskeleton / response to ethanol / learning or memory / calmodulin binding / postsynaptic membrane / lysosome / neuron projection / postsynaptic density / calcium ion binding / synapse / dendrite / endoplasmic reticulum membrane / protein-containing complex binding / glutamatergic synapse / cell surface / positive regulation of transcription by RNA polymerase II / zinc ion binding / plasma membrane / cytoplasm Similarity search - Function | ||||||||||||||||||||||||
| Biological species | Homo sapiens (human) | ||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.65 Å | ||||||||||||||||||||||||
Authors | Hyunook, K. / Hiro, F. | ||||||||||||||||||||||||
| Funding support | United States, 2items
| ||||||||||||||||||||||||
Citation | Journal: Neuron / Year: 2025Title: Structural basis for channel gating and blockade in tri-heteromeric GluN1-2B-2D NMDA receptor. Authors: Hyunook Kang / Max Epstein / Tue G Banke / Riley Perszyk / Noriko Simorowski / Srinu Paladugu / Dennis C Liotta / Stephen F Traynelis / Hiro Furukawa / ![]() Abstract: Discrete activation of N-methyl-D-aspartate receptor (NMDAR) subtypes by glutamate and the co-agonist glycine is fundamental to neuroplasticity. A distinct variant, the tri-heteromeric receptor, ...Discrete activation of N-methyl-D-aspartate receptor (NMDAR) subtypes by glutamate and the co-agonist glycine is fundamental to neuroplasticity. A distinct variant, the tri-heteromeric receptor, comprising glycine-binding GluN1 and two types of glutamate-binding GluN2 subunits, exhibits unique pharmacological characteristics, notably enhanced sensitivity to the anti-depressant channel blocker S-(+)-ketamine. Despite its significance, the structural mechanisms underlying ligand gating and channel blockade of tri-heteromeric NMDARs remain poorly understood. Here, we identify and characterize tri-heteromeric GluN1-2B-2D NMDAR in the adult brain, resolving its structures in the activated, inhibited, and S-(+)-ketamine-blocked states. These structures reveal the ligand-dependent conformational dynamics that modulate the tension between the extracellular domain and transmembrane channels, governing channel gating and blockade. Additionally, we demonstrate that the inhibitor (S)-DQP-997-74 selectively decouples linker tension in GluN2D, offering insights into subtype-selective targeting for cognitive modulation. | ||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9d39.cif.gz | 557.3 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9d39.ent.gz | 441.7 KB | Display | PDB format |
| PDBx/mmJSON format | 9d39.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/d3/9d39 ftp://data.pdbj.org/pub/pdb/validation_reports/d3/9d39 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 46528MC ![]() 9d37C ![]() 9d38C ![]() 9d3aC ![]() 9d3bC ![]() 9d3cC C: citing same article ( M: map data used to model this data |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-Glutamate receptor ionotropic, NMDA ... , 3 types, 4 molecules ACBD
| #1: Protein | Mass: 92691.828 Da / Num. of mol.: 2 / Mutation: R844N, R845G, K846A Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: GRIN1, NMDAR1 / Production host: ![]() #2: Protein | | Mass: 98622.172 Da / Num. of mol.: 1 / Mutation: C588S, C838S, C849S Source method: isolated from a genetically manipulated source Details: Twin-strep tag WSHPQFEKGGGSGGGSGGSAWSHPQFEKGALVPRG C-terminal p2A tag GSGATNFSLLKQAGDVEENPG Source: (gene. exp.) Homo sapiens (human) / Gene: GRIN2B, NMDAR2B / Production host: ![]() #3: Protein | | Mass: 94120.609 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: GRIN2D, GluN2D, NMDAR2D / Production host: ![]() |
|---|
-Sugars , 1 types, 3 molecules 
| #5: Sugar |
|---|
-Non-polymers , 2 types, 4 molecules 


| #4: Chemical | | #6: Chemical | |
|---|
-Details
| Has ligand of interest | Y |
|---|---|
| Has protein modification | Y |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Tri-heteromeric GluN1a-2B-2D NMDAR / Type: COMPLEX / Entity ID: #1-#3 / Source: RECOMBINANT |
|---|---|
| Molecular weight | Value: 0.377 MDa / Experimental value: NO |
| Source (natural) | Organism: Homo sapiens (human) |
| Source (recombinant) | Organism: ![]() |
| Buffer solution | pH: 7.5 |
| Specimen | Conc.: 2 mg/ml / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Specimen support | Grid material: COPPER / Grid type: Quantifoil R1.2/1.3 |
| Vitrification | Cryogen name: ETHANE / Humidity: 100 % / Chamber temperature: 278 K |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2400 nm / Nominal defocus min: 1000 nm |
| Specimen holder | Cryogen: NITROGEN |
| Image recording | Electron dose: 59.1 e/Å2 / Film or detector model: GATAN K3 BIOQUANTUM (6k x 4k) |
| EM imaging optics | Energyfilter name: GIF Bioquantum / Energyfilter slit width: 14 eV |
-
Processing
| EM software |
| ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: NONE | ||||||||||||||||||||||||||||||
| Particle selection | Num. of particles selected: 827614 | ||||||||||||||||||||||||||||||
| Symmetry | Point symmetry: C1 (asymmetric) | ||||||||||||||||||||||||||||||
| 3D reconstruction | Resolution: 3.65 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 72214 / Symmetry type: POINT | ||||||||||||||||||||||||||||||
| Atomic model building | Protocol: RIGID BODY FIT / Space: REAL | ||||||||||||||||||||||||||||||
| Atomic model building | 3D fitting-ID: 1 / Source name: PDB / Type: experimental model
| ||||||||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi




Homo sapiens (human)
United States, 2items
Citation
























PDBj
















FIELD EMISSION GUN
