+
Open data
-
Basic information
| Entry | Database: PDB / ID: 8zy1 | |||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Sarbecovirus BM48-31 Spike Trimer in a Locked Conformation | |||||||||||||||||||||||||||||||||
Components | Spike glycoprotein | |||||||||||||||||||||||||||||||||
Keywords | VIRAL PROTEIN / spike protein | |||||||||||||||||||||||||||||||||
| Function / homology | Function and homology informationhost cell endoplasmic reticulum-Golgi intermediate compartment membrane / receptor-mediated virion attachment to host cell / endocytosis involved in viral entry into host cell / fusion of virus membrane with host plasma membrane / fusion of virus membrane with host endosome membrane / viral envelope / host cell plasma membrane / virion membrane / membrane Similarity search - Function | |||||||||||||||||||||||||||||||||
| Biological species | Bat coronavirus BM48-31/BGR/2008 | |||||||||||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.1 Å | |||||||||||||||||||||||||||||||||
Authors | Wang, J. / Xiong, X. | |||||||||||||||||||||||||||||||||
| Funding support | 2items
| |||||||||||||||||||||||||||||||||
Citation | Journal: Sci Adv / Year: 2025Title: SARS-related coronavirus S-protein structures reveal synergistic RBM interactions underpinning high-affinity human ACE2 binding. Authors: Jingjing Wang / Yong Ma / Zimu Li / Hang Yuan / Banghui Liu / Zexuan Li / Mengzhen Su / Gul Habib / Yutong Liu / Lutang Fu / Peiyi Wang / Mei Li / Jun He / Jing Chen / Peng Zhou / Zhengli ...Authors: Jingjing Wang / Yong Ma / Zimu Li / Hang Yuan / Banghui Liu / Zexuan Li / Mengzhen Su / Gul Habib / Yutong Liu / Lutang Fu / Peiyi Wang / Mei Li / Jun He / Jing Chen / Peng Zhou / Zhengli Shi / Xinwen Chen / Xiaoli Xiong / ![]() Abstract: High-affinity and specific binding toward the human angiotensin-converting enzyme 2 (hACE2) receptor by severe acute respiratory syndrome coronavirus (SARS)-related coronaviruses (SARSr-CoVs) remains ...High-affinity and specific binding toward the human angiotensin-converting enzyme 2 (hACE2) receptor by severe acute respiratory syndrome coronavirus (SARS)-related coronaviruses (SARSr-CoVs) remains incompletely understood. We report cryo-electron microscopy structures of eight different S-proteins from SARSr-CoVs found across Asia, Europe, and Africa. These S-proteins all adopt tightly packed, locked, prefusion conformations. These structures enable the classification of SARSr-CoV S-proteins into three types, based on their receptor-binding motif (RBM) structures and ACE2 binding characteristics. Type-2 S-proteins often preferentially bind bat ACE2 (bACE2) over hACE2. We report a structure of a type-2 BtKY72-RBD in complex with bACE2 to understand ACE2 specificity. Structure-guided mutagenesis of BtKY72-RBD reveals that multiple synergistic mutations in four different regions of RBM are required to achieve high-affinity hACE2 binding. Similar RBM changes can also confer hACE2 binding to another type-2 BM48-31 S-protein, which is primarily non-ACE2 binding. These results provide an understanding of how high-affinity hACE2 binding may be acquired by SARSr-CoV S-proteins. | |||||||||||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 8zy1.cif.gz | 655 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb8zy1.ent.gz | 532.9 KB | Display | PDB format |
| PDBx/mmJSON format | 8zy1.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Summary document | 8zy1_validation.pdf.gz | 1.9 MB | Display | wwPDB validaton report |
|---|---|---|---|---|
| Full document | 8zy1_full_validation.pdf.gz | 1.9 MB | Display | |
| Data in XML | 8zy1_validation.xml.gz | 60.6 KB | Display | |
| Data in CIF | 8zy1_validation.cif.gz | 93.8 KB | Display | |
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/zy/8zy1 ftp://data.pdbj.org/pub/pdb/validation_reports/zy/8zy1 | HTTPS FTP |
-Related structure data
| Related structure data | ![]() 60552MC ![]() 8zy0C ![]() 8zy2C ![]() 8zy3C ![]() 8zy4C ![]() 8zy5C ![]() 8zy6C ![]() 8zy7C ![]() 8zy9C ![]() 8zyaC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
| #1: Protein | Mass: 140690.406 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: T4 trimerization foldon:GSGYIPEAPRDGQAYVRKDGEWVLLSTFL HRV 3C cleavage site:LEVLFQGP His-tag:HHHHHHHH strep tag:WSHPQFEKGGGSGGGGSGGSAWSHPQFEKSA Source: (gene. exp.) Bat coronavirus BM48-31/BGR/2008 / Cell (production host): 293F / Production host: Homo sapiens (human) / References: UniProt: E0XIZ3#2: Polysaccharide | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose Source method: isolated from a genetically manipulated source #3: Polysaccharide | Source method: isolated from a genetically manipulated source #4: Sugar | ChemComp-NAG / #5: Chemical | Has ligand of interest | Y | Has protein modification | Y | |
|---|
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: the spike protein of sarbecovirus BM48-31 / Type: ORGANELLE OR CELLULAR COMPONENT / Details: the spike trimer / Entity ID: #1 / Source: RECOMBINANT | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular weight | Value: 0.42 MDa / Experimental value: YES | |||||||||||||||||||||||||
| Source (natural) | Organism: BM48-31 (virus) | |||||||||||||||||||||||||
| Source (recombinant) | Organism: Homo sapiens (human) | |||||||||||||||||||||||||
| Details of virus | Empty: YES / Enveloped: NO / Isolate: STRAIN / Type: VIROID | |||||||||||||||||||||||||
| Buffer solution | pH: 7.4 Details: 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, and 1.8 mM KH2PO4. | |||||||||||||||||||||||||
| Buffer component |
| |||||||||||||||||||||||||
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES | |||||||||||||||||||||||||
| Vitrification | Instrument: FEI VITROBOT MARK IV / Cryogen name: ETHANE / Humidity: 100 % / Chamber temperature: 277 K |
-
Electron microscopy imaging
| Microscopy | Model: FEI TITAN |
|---|---|
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: OTHER |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2200 nm / Nominal defocus min: 800 nm / Cs: 2.7 mm |
| Image recording | Electron dose: 50 e/Å2 / Film or detector model: GATAN K3 (6k x 4k) |
-
Processing
| EM software |
| ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 3.1 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 79256 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi




Bat coronavirus BM48-31/BGR/2008
Citation



















PDBj
Homo sapiens (human)

FIELD EMISSION GUN