[English] 日本語

- PDB-7rjb: Complex III2 from Candida albicans, inhibitor free, Rieske head d... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 7rjb | ||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Title | Complex III2 from Candida albicans, inhibitor free, Rieske head domain in b position | ||||||||||||||||||
![]() |
| ||||||||||||||||||
![]() | MEMBRANE PROTEIN / Candida albicans / mitochondrial complex III2 / indazole-derivative inhibitor / Rieske head domain | ||||||||||||||||||
Function / homology | ![]() regulation of filamentous growth / matrix side of mitochondrial inner membrane / protein processing involved in protein targeting to mitochondrion / mitochondrial respiratory chain complex III assembly / respiratory chain complex III / quinol-cytochrome-c reductase / quinol-cytochrome-c reductase activity / mitochondrial electron transport, ubiquinol to cytochrome c / mitochondrial crista / heterochromatin ...regulation of filamentous growth / matrix side of mitochondrial inner membrane / protein processing involved in protein targeting to mitochondrion / mitochondrial respiratory chain complex III assembly / respiratory chain complex III / quinol-cytochrome-c reductase / quinol-cytochrome-c reductase activity / mitochondrial electron transport, ubiquinol to cytochrome c / mitochondrial crista / heterochromatin / aerobic respiration / metalloendopeptidase activity / 2 iron, 2 sulfur cluster binding / electron transfer activity / oxidoreductase activity / mitochondrial inner membrane / heme binding / mitochondrion / metal ion binding / membrane / plasma membrane Similarity search - Function | ||||||||||||||||||
Biological species | ![]() | ||||||||||||||||||
Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.2 Å | ||||||||||||||||||
![]() | Di Trani, J.M. / Rubinstein, J.L. | ||||||||||||||||||
Funding support | ![]() ![]()
| ||||||||||||||||||
![]() | ![]() Title: Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III. Authors: Justin M Di Trani / Zhongle Liu / Luke Whitesell / Peter Brzezinski / Leah E Cowen / John L Rubinstein / ![]() ![]() Abstract: Electron transfer between respiratory complexes drives transmembrane proton translocation, which powers ATP synthesis and membrane transport. The homodimeric respiratory complex III (CIII) oxidizes ...Electron transfer between respiratory complexes drives transmembrane proton translocation, which powers ATP synthesis and membrane transport. The homodimeric respiratory complex III (CIII) oxidizes ubiquinol to ubiquinone, transferring electrons to cytochrome c and translocating protons through a mechanism known as the Q cycle. The Q cycle involves ubiquinol oxidation and ubiquinone reduction at two different sites within each CIII monomer, as well as movement of the head domain of the Rieske subunit. We determined structures of Candida albicans CIII by cryoelectron microscopy (cryo-EM), revealing endogenous ubiquinone and visualizing the continuum of Rieske head domain conformations. Analysis of these conformations does not indicate cooperativity in the Rieske head domain position or ligand binding in the two CIIIs of the CIII dimer. Cryo-EM with the indazole derivative Inz-5, which inhibits fungal CIII and is fungicidal when administered with fungistatic azole drugs, showed that Inz-5 inhibition alters the equilibrium of Rieske head domain positions. | ||||||||||||||||||
History |
|
-
Structure visualization
Movie |
![]() |
---|---|
Structure viewer | Molecule: ![]() ![]() |
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 610 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 497.4 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 1.1 MB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 1.1 MB | Display | |
Data in XML | ![]() | 61.6 KB | Display | |
Data in CIF | ![]() | 93.1 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 24483MC ![]() 7rjaC ![]() 7rjcC ![]() 7rjdC ![]() 7rjeC C: citing same article ( M: map data used to model this data |
---|---|
Similar structure data |
-
Links
-
Assembly
Deposited unit | ![]()
|
---|---|
1 |
|
-
Components
-Ubiquinol--cytochrome-c reductase ... , 5 types, 5 molecules ADFHI
#1: Protein | Mass: 48004.805 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: A0A1D8PP59 |
---|---|
#3: Protein | Mass: 32261.389 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: A0A1D8PHA3 |
#5: Protein | Mass: 11125.672 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: A0A1D8PHA2 |
#6: Protein | Mass: 16042.014 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: A0A1D8PJT8 |
#7: Protein | Mass: 7518.448 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Details: ATIFGGAFAFQGFFDVAVNKWWEEHNKAKLWKNVKGKFL Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: A0A1D8PLP3 |
-Protein , 1 types, 1 molecules K
#2: Protein | Mass: 43738.457 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: P0C8L0 |
---|
-Cytochrome b-c1 complex subunit ... , 3 types, 4 molecules GBME
#4: Protein | Mass: 14440.710 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: Q5ABS1 |
---|---|
#8: Protein | Mass: 39593.352 Da / Num. of mol.: 1 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 / References: UniProt: P83782 |
#9: Protein | Mass: 23233.385 Da / Num. of mol.: 2 / Source method: isolated from a natural source Source: (natural) ![]() Strain: SC5314 / ATCC MYA-2876 References: UniProt: A0A1D8PJX3, quinol-cytochrome-c reductase |
-Non-polymers , 4 types, 6 molecules 






#10: Chemical | #11: Chemical | #12: Chemical | ChemComp-HEC / | #13: Chemical | ChemComp-FES / | |
---|
-Details
Has ligand of interest | N |
---|---|
Has protein modification | Y |
-Experimental details
-Experiment
Experiment | Method: ELECTRON MICROSCOPY |
---|---|
EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
Component | Name: Respiratory complex III2 from Candida albicans / Type: COMPLEX / Entity ID: #1-#9 / Source: NATURAL |
---|---|
Source (natural) | Organism: ![]() |
Buffer solution | pH: 7.4 |
Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
Vitrification | Cryogen name: ETHANE-PROPANE |
-
Electron microscopy imaging
Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
---|---|
Microscopy | Model: TFS KRIOS |
Electron gun | Electron source: ![]() |
Electron lens | Mode: BRIGHT FIELD |
Image recording | Electron dose: 42 e/Å2 / Film or detector model: FEI FALCON IV (4k x 4k) |
-
Processing
CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION |
---|---|
3D reconstruction | Resolution: 3.2 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 56373 / Symmetry type: POINT |