+
Open data
-
Basic information
Entry | Database: PDB / ID: 6saz | |||||||||
---|---|---|---|---|---|---|---|---|---|---|
Title | Cleaved human fetuin-b in complex with crayfish astacin | |||||||||
![]() |
| |||||||||
![]() | HYDROLASE / mammalian fertilization / sperm-egg fusion / polyspermy / metallopeptidase / protein inhibitor / limited proteolysis | |||||||||
Function / homology | ![]() astacin / glutamic-type peptidase activity / negative regulation of binding of sperm to zona pellucida / aspartic-type peptidase activity / prevention of polyspermy / cortical granule / metalloendopeptidase inhibitor activity / negative regulation of endopeptidase activity / positive regulation of protein processing / binding of sperm to zona pellucida ...astacin / glutamic-type peptidase activity / negative regulation of binding of sperm to zona pellucida / aspartic-type peptidase activity / prevention of polyspermy / cortical granule / metalloendopeptidase inhibitor activity / negative regulation of endopeptidase activity / positive regulation of protein processing / binding of sperm to zona pellucida / fertilization / cysteine-type endopeptidase inhibitor activity / single fertilization / metalloendopeptidase activity / peptidase activity / cell adhesion / proteolysis / extracellular exosome / extracellular region / zinc ion binding / plasma membrane / cytoplasm Similarity search - Function | |||||||||
Biological species | ![]() ![]() | |||||||||
Method | ![]() ![]() ![]() | |||||||||
![]() | Gomis-Ruth, F.X. / Guevara, T. / Cuppari, A. / Korschgen, H. / Schmitz, C. / Kuske, M. / Yiallouros, I. / Floehr, J. / Jahnen-Dechent, W. / Stocker, W. | |||||||||
![]() | ![]() Title: The C-terminal region of human plasma fetuin-B is dispensable for the raised-elephant-trunk mechanism of inhibition of astacin metallopeptidases. Authors: Guevara, T. / Korschgen, H. / Cuppari, A. / Schmitz, C. / Kuske, M. / Yiallouros, I. / Floehr, J. / Jahnen-Dechent, W. / Stocker, W. / Gomis-Ruth, F.X. #1: ![]() Title: Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition. Authors: Cuppari, A. / Korschgen, H. / Fahrenkamp, D. / Schmitz, C. / Guevara, T. / Karmilin, K. / Kuske, M. / Olf, M. / Dietzel, E. / Yiallouros, I. / de Sanctis, D. / Goulas, T. / Weiskirchen, R. / ...Authors: Cuppari, A. / Korschgen, H. / Fahrenkamp, D. / Schmitz, C. / Guevara, T. / Karmilin, K. / Kuske, M. / Olf, M. / Dietzel, E. / Yiallouros, I. / de Sanctis, D. / Goulas, T. / Weiskirchen, R. / Jahnen-Dechent, W. / Floehr, J. / Stoecker, W. / Jovine, L. / Gomis-Ruth, F.X. | |||||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 371 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 302 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 2.2 MB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 2.2 MB | Display | |
Data in XML | ![]() | 30.8 KB | Display | |
Data in CIF | ![]() | 43.1 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 6ht9S S: Starting model for refinement |
---|---|
Similar structure data |
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||
---|---|---|---|---|---|---|---|---|---|
1 | ![]()
| ||||||||
2 | ![]()
| ||||||||
Unit cell |
|
-
Components
-Protein , 2 types, 4 molecules ACBD
#1: Protein | Mass: 22913.318 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) ![]() #2: Protein | Mass: 42097.820 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Details: Sequence stretches MGLLLPLALCILVLCCGAMSPPQL, CTKSQASSCSLQS, SQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKA, and PLVLPP missing from coordinate file. Source: (gene. exp.) ![]() ![]() ![]() |
---|
-Sugars , 3 types, 4 molecules 
#3: Polysaccharide | Source method: isolated from a genetically manipulated source #4: Polysaccharide | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose | Source method: isolated from a genetically manipulated source #6: Sugar | ChemComp-NAG / | |
---|
-Non-polymers , 2 types, 33 molecules 


#5: Chemical | #7: Water | ChemComp-HOH / | |
---|
-Details
Has ligand of interest | Y |
---|---|
Has protein modification | Y |
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 3.46 Å3/Da / Density % sol: 64.48 % |
---|---|
Crystal grow | Temperature: 293 K / Method: vapor diffusion, sitting drop Details: Crystallization assays were set up following the sitting-drop vapor diffusion method at the joint IBMB/IRB Automated Crystallography Platform of Barcelona Science Park. A Tecan robot (Tecan ...Details: Crystallization assays were set up following the sitting-drop vapor diffusion method at the joint IBMB/IRB Automated Crystallography Platform of Barcelona Science Park. A Tecan robot (Tecan Trading) was used to prepare reservoir solutions, and a Cartesian Microsys 4000 XL robot (Genomic Solutions) or a Phoenix nanodrop robot (Art Robbins Instruments) dispensed nanocrystallization drops on 96x2-well Swissci Polystyrene MRC Crystallization Plates (Molecular Dimensions). Plates were stored at 4 or 20 degrees in thermostatic crystal farms (Bruker AXS). The astacin-hFB complex only crystallized after incubating the inhibitor (at 7.5 mg/mL) with six-fold molar excess of the peptidase in 10 mM Tris-HCl, 140 mM sodium chloride, pH 6.8. Crystals were obtained at 20 degrees in 200 nL:100 nL drops with protein complex solution and 20 percent (w/v) polyethylene glycol 3,350, 0.2 M sodium tartrate dibasic as reservoir solution. |
-Data collection
Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
---|---|
Diffraction source | Source: ![]() ![]() ![]() |
Detector | Type: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Nov 11, 2018 |
Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
Radiation wavelength | Wavelength: 1.0032 Å / Relative weight: 1 |
Reflection | Resolution: 3→78.5 Å / Num. obs: 26287 / % possible obs: 99.7 % / Redundancy: 9.2 % / Biso Wilson estimate: 70.5 Å2 / CC1/2: 0.996 / Rmerge(I) obs: 0.184 / Rrim(I) all: 0.195 / Net I/σ(I): 11.1 |
Reflection shell | Resolution: 3→3.18 Å / Redundancy: 8.9 % / Rmerge(I) obs: 1.565 / Num. unique obs: 4165 / CC1/2: 0.626 / Rrim(I) all: 1.66 / % possible all: 98.9 |
-
Processing
Software |
| ||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]() Starting model: 6HT9 Resolution: 3→78.5 Å / Cross valid method: FREE R-VALUE
| ||||||||||||||||||||
Displacement parameters | Biso mean: 82.4 Å2 | ||||||||||||||||||||
Refinement step | Cycle: LAST / Resolution: 3→78.5 Å
|