[English] 日本語
Yorodumi
- PDB-6feg: Solution Structure of CaM/Kv7.2-hAB Complex -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 6feg
TitleSolution Structure of CaM/Kv7.2-hAB Complex
Components
  • Calmodulin-1
  • Potassium voltage-gated channel subfamily KQT member 2,Potassium voltage-gated channel subfamily KQT member 2
KeywordsMETAL TRANSPORT / Voltage-gated potassium channel / Calmodulin / Complex / Transport / Calcium-signalling
Function / homology
Function and homology information


axon initial segment / Voltage gated Potassium channels / node of Ranvier / Interaction between L1 and Ankyrins / CaM pathway / Cam-PDE 1 activation / Sodium/Calcium exchangers / Calmodulin induced events / Reduction of cytosolic Ca++ levels / CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde ...axon initial segment / Voltage gated Potassium channels / node of Ranvier / Interaction between L1 and Ankyrins / CaM pathway / Cam-PDE 1 activation / Sodium/Calcium exchangers / Calmodulin induced events / Reduction of cytosolic Ca++ levels / CREB1 phosphorylation through the activation of CaMKII/CaMKK/CaMKIV cascasde / Activation of Ca-permeable Kainate Receptor / Loss of phosphorylation of MECP2 at T308 / CREB1 phosphorylation through the activation of Adenylate Cyclase / PKA activation / ankyrin binding / negative regulation of high voltage-gated calcium channel activity / CaMK IV-mediated phosphorylation of CREB / Glycogen breakdown (glycogenolysis) / positive regulation of cyclic-nucleotide phosphodiesterase activity / organelle localization by membrane tethering / negative regulation of calcium ion export across plasma membrane / CLEC7A (Dectin-1) induces NFAT activation / regulation of cardiac muscle cell action potential / mitochondrion-endoplasmic reticulum membrane tethering / autophagosome membrane docking / Activation of RAC1 downstream of NMDARs / positive regulation of ryanodine-sensitive calcium-release channel activity / regulation of cell communication by electrical coupling involved in cardiac conduction / Negative regulation of NMDA receptor-mediated neuronal transmission / negative regulation of peptidyl-threonine phosphorylation / Synthesis of IP3 and IP4 in the cytosol / Unblocking of NMDA receptors, glutamate binding and activation / Phase 0 - rapid depolarisation / voltage-gated potassium channel activity / protein phosphatase activator activity / RHO GTPases activate PAKs / positive regulation of phosphoprotein phosphatase activity / Ion transport by P-type ATPases / Long-term potentiation / Uptake and function of anthrax toxins / Calcineurin activates NFAT / Regulation of MECP2 expression and activity / catalytic complex / DARPP-32 events / detection of calcium ion / regulation of cardiac muscle contraction / negative regulation of ryanodine-sensitive calcium-release channel activity / Smooth Muscle Contraction / RHO GTPases activate IQGAPs / calcium channel inhibitor activity / cellular response to interferon-beta / regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion / Protein methylation / eNOS activation / Activation of AMPK downstream of NMDARs / regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum / Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation / positive regulation of protein dephosphorylation / Ion homeostasis / regulation of calcium-mediated signaling / regulation of ryanodine-sensitive calcium-release channel activity / titin binding / potassium ion transmembrane transport / positive regulation of protein autophosphorylation / voltage-gated potassium channel complex / sperm midpiece / calcium channel complex / substantia nigra development / adenylate cyclase activator activity / Ras activation upon Ca2+ influx through NMDA receptor / regulation of heart rate / sarcomere / protein serine/threonine kinase activator activity / FCERI mediated Ca+2 mobilization / FCGR3A-mediated IL10 synthesis / VEGFR2 mediated vascular permeability / positive regulation of peptidyl-threonine phosphorylation / regulation of cytokinesis / Antigen activates B Cell Receptor (BCR) leading to generation of second messengers / VEGFR2 mediated cell proliferation / Translocation of SLC2A4 (GLUT4) to the plasma membrane / positive regulation of receptor signaling pathway via JAK-STAT / RAF activation / Transcriptional activation of mitochondrial biogenesis / positive regulation of protein serine/threonine kinase activity / spindle microtubule / Stimuli-sensing channels / cellular response to type II interferon / spindle pole / response to calcium ion / RAS processing / Signaling by RAF1 mutants / G2/M transition of mitotic cell cycle / Signaling by moderate kinase activity BRAF mutants / Paradoxical activation of RAF signaling by kinase inactive BRAF / Signaling downstream of RAS mutants / calcium-dependent protein binding / Inactivation, recovery and regulation of the phototransduction cascade / Signaling by BRAF and RAF1 fusions / Platelet degranulation
Similarity search - Function
Potassium channel, voltage dependent, KCNQ2 / Ankyrin-G binding site / Ankyrin-G binding motif of KCNQ2-3 / Unstructured region on Potassium channel subunit alpha KvLQT2 / Potassium channel, voltage dependent, KCNQ / Potassium channel, voltage dependent, KCNQ, C-terminal / KCNQ voltage-gated potassium channel / EF-hand domain pair / EF-hand, calcium binding motif / EF-Hand 1, calcium-binding site ...Potassium channel, voltage dependent, KCNQ2 / Ankyrin-G binding site / Ankyrin-G binding motif of KCNQ2-3 / Unstructured region on Potassium channel subunit alpha KvLQT2 / Potassium channel, voltage dependent, KCNQ / Potassium channel, voltage dependent, KCNQ, C-terminal / KCNQ voltage-gated potassium channel / EF-hand domain pair / EF-hand, calcium binding motif / EF-Hand 1, calcium-binding site / EF-hand calcium-binding domain. / EF-hand calcium-binding domain profile. / EF-hand domain / Ion transport domain / Ion transport protein / EF-hand domain pair
Similarity search - Domain/homology
Potassium voltage-gated channel subfamily KQT member 2 / Calmodulin-1
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodSOLUTION NMR / torsion angle dynamics
AuthorsBernardo-Seisdedos, G. / Villarroel, A. / Millet, O.
Funding support Spain, 2items
OrganizationGrant numberCountry
Basque GovernmentElkartek BG2015 Spain
Spanish Ministry of Science and TechnologyCTQ2015-68756-R, BFU2015-66910-R and CSD2008-00005 Spain
CitationJournal: Proc. Natl. Acad. Sci. U.S.A. / Year: 2018
Title: Structural basis and energy landscape for the Ca2+gating and calmodulation of the Kv7.2 K+channel.
Authors: Bernardo-Seisdedos, G. / Nunez, E. / Gomis, C. / Malo, C. / Villarroel, A. / Millet, O.
History
DepositionJan 2, 2018Deposition site: PDBE / Processing site: PDBE
Revision 1.0Feb 21, 2018Provider: repository / Type: Initial release
Revision 1.1Mar 28, 2018Group: Data collection / Database references / Category: citation / citation_author
Item: _citation.journal_abbrev / _citation.journal_volume ..._citation.journal_abbrev / _citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_PubMed / _citation.title / _citation_author.name
Revision 1.2May 8, 2019Group: Data collection / Category: pdbx_nmr_software / Item: _pdbx_nmr_software.name
Revision 1.3May 15, 2024Group: Data collection / Database references
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_nmr_spectrometer
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession / _pdbx_nmr_spectrometer.model

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Potassium voltage-gated channel subfamily KQT member 2,Potassium voltage-gated channel subfamily KQT member 2
B: Calmodulin-1
hetero molecules


Theoretical massNumber of molelcules
Total (without water)30,5324
Polymers30,4522
Non-polymers802
Water00
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration, native gel electrophoresis
TypeNameSymmetry operationNumber
identity operation1_5551
Buried area4120 Å2
ΔGint-35 kcal/mol
Surface area19260 Å2
MethodPISA
NMR ensembles
DataCriteria
Number of conformers (submitted / calculated)10 / 200structures with the least restraint violations
RepresentativeModel #1lowest energy

-
Components

#1: Protein Potassium voltage-gated channel subfamily KQT member 2,Potassium voltage-gated channel subfamily KQT member 2 / KQT-like 2 / Neuroblastoma-specific potassium channel subunit alpha KvLQT2 / Voltage-gated ...KQT-like 2 / Neuroblastoma-specific potassium channel subunit alpha KvLQT2 / Voltage-gated potassium channel subunit Kv7.2


Mass: 13599.536 Da / Num. of mol.: 1 / Mutation: Del. R374-K493,Del. R374-K493
Source method: isolated from a genetically manipulated source
Details: ...Details: MSYYHHHHHHDYDIPTTENLYFQGAMGILGSGQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRGLEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRLD,MSYYHHHHHHDYDIPTTENLYFQGAMGILGSGQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRGLEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRLD
Source: (gene. exp.) Homo sapiens (human) / Gene: KCNQ2 / Plasmid: pPROEX-HTc / Production host: Escherichia coli (E. coli) / References: UniProt: O43526
#2: Protein Calmodulin-1 / Calmodulin


Mass: 16852.545 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: ...Details: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Source: (gene. exp.) Homo sapiens (human) / Gene: CALM1, CALM, CAM, CAM1 / Plasmid: pOKD4 / Production host: Escherichia coli (E. coli) / References: UniProt: P0DP23
#3: Chemical ChemComp-CA / CALCIUM ION


Mass: 40.078 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: Ca

-
Experimental details

-
Experiment

ExperimentMethod: SOLUTION NMR
NMR experiment
Conditions-IDExperiment-IDSolution-IDSample stateSpectrometer-IDType
111isotropic12D 1H-15N TROSY-HSQC
121isotropic12D 1H-13C TROSY-HSQC
161isotropic13D HNCA
131isotropic13D HN(CO)CA
141isotropic13D HN(CA)CB
151isotropic13D HN(COCA)CB
171isotropic13D HNCO
1101isotropic13D HN(CA)CO
181isotropic13D HN(CA)HA
191isotropic13D HN(COCA)HA
1111isotropic13D H(CCO)NH
1121isotropic13D HNC(CCO)NH
1131isotropic13D 1H-15N NOESY
1141isotropic13D 1H-13C NOESY
1371isotropic22D 1H-15N TROSY-HSQC
1334isotropic12D 1H-15N TROSY-HSQC
1344isotropic12D 1H-15N semiTROSY-HSQC
1354anisotropic12D 1H-15N TROSY-HSQC
1364anisotropic12D 1H-15N semiTROSY-HSQC
1152isotropic12D 1H-15N TROSY-HSQC
1162isotropic12D 1H-13C TROSY-HSQC
1172isotropic13D HNCA
1182isotropic13D HN(CO)CA
1192isotropic13D HN(CA)CB
1202isotropic13D HN(COCA)CB
1212isotropic13D HNCO
1222isotropic13D HN(CA)CO
1232isotropic13D HN(CA)HA
1242isotropic13D HN(COCA)HA
1252isotropic13D H(CCO)NH
1262isotropic13D HNC(CCO)NH
1272isotropic13D 1H-15N NOESY
1282isotropic13D 1H-13C NOESY
1382isotropic22D 1H-15N TROSY-HSQC
1293isotropic12D 1H-15N TROSY-HSQC
1303isotropic13D HNCA
1313isotropic13D HNCO
1323isotropic13D HN(CA)HA

-
Sample preparation

Details
TypeSolution-IDContentsLabelSolvent system
solution11 mM [U-100% 13C; U-100% 15N; U-50% 2H] Kv7.2-hAB, 1 mM [U-100% 13C; U-100% 15N; U-50% 2H] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O2H_13C_15N_complex95% H2O/5% D2O
solution2500 uM [U-100% 13C; U-100% 15N] Kv7.2-hAB, 500 uM Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O13C_15N_Kv7.2-hAB95% H2O/5% D2O
solution3500 uM Kv7.2-hAB, 500 uM [U-100% 13C; U-100% 15N] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O13C_15N_CaM95% H2O/5% D2O
solution4250 uM [U-100% 15N] Kv7.2-hAB, 250 uM [U-100% 15N] Calmodulin, 120 mM potassium chloride, 20 mM MES, 2 uM sodium azide, 200 uM [U-2H] DSS, 95% H2O/5% D2O15N_complex95% H2O/5% D2O
Sample
Conc. (mg/ml)ComponentIsotopic labelingSolution-ID
1 mMKv7.2-hAB[U-100% 13C; U-100% 15N; U-50% 2H]1
1 mMCalmodulin[U-100% 13C; U-100% 15N; U-50% 2H]1
120 mMpotassium chloridenatural abundance1
20 mMMESnatural abundance1
2 uMsodium azidenatural abundance1
200 uMDSS[U-2H]1
500 uMKv7.2-hAB[U-100% 13C; U-100% 15N]2
500 uMCalmodulinnatural abundance2
120 mMpotassium chloridenatural abundance2
20 mMMESnatural abundance2
2 uMsodium azidenatural abundance2
200 uMDSS[U-2H]2
500 uMKv7.2-hABnatural abundance3
500 uMCalmodulin[U-100% 13C; U-100% 15N]3
120 mMpotassium chloridenatural abundance3
20 mMMESnatural abundance3
2 uMsodium azidenatural abundance3
200 uMDSS[U-2H]3
250 uMKv7.2-hAB[U-100% 15N]4
250 uMCalmodulin[U-100% 15N]4
120 mMpotassium chloridenatural abundance4
20 mMMESnatural abundance4
2 uMsodium azidenatural abundance4
200 uMDSS[U-2H]4
Sample conditionsIonic strength: 120 mM / Label: general_conditions / pH: 6 / Pressure: 1 atm / Temperature: 303 K

-
NMR measurement

NMR spectrometer
TypeManufacturerModelField strength (MHz)Spectrometer-ID
Bruker AVANCE IIIBrukerAVANCE III8001
Bruker AVANCE IIIBrukerAVANCE III6002

-
Processing

NMR software
NameVersionDeveloperClassification
TopSpin3.1Bruker Biospincollection
Sparky3.115Goddardchemical shift assignment
Sparky3.115Goddardpeak picking
Sparky3.115Goddarddata analysis
CcpNmr Analysis2.4CCPNchemical shift assignment
CcpNmr Analysis2.4CCPNdata analysis
NMRPipe8.2Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Baxprocessing
ARIA2.3.1Linge, O'Donoghue and Nilgesstructure calculation
ARIA2.3.1Linge, O'Donoghue and Nilgesdata analysis
ARIA2.3.1Linge, O'Donoghue and Nilgesrefinement
PROCHECK / PROCHECK-NMRLaskowski and MacArthurdata analysis
MolProbityRichardsondata analysis
AQUARullmann, Doreleijers and Kapteindata analysis
RefinementMethod: torsion angle dynamics / Software ordinal: 8
NMR representativeSelection criteria: lowest energy
NMR ensembleConformer selection criteria: structures with the least restraint violations
Conformers calculated total number: 200 / Conformers submitted total number: 10

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbjlvh1.pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more