[English] 日本語
Yorodumi- PDB-5uiw: Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex wi... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 5uiw | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Title | Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV entry inhibitor 5P7-CCL5 | |||||||||
Components |
| |||||||||
Keywords | SIGNALING PROTEIN / G-protein coupled receptor / Chemokine receptor / HIV entry inhibitor / HIV-1 R5 isolates co-receptor / receptor-ligand complex | |||||||||
| Function / homology | Function and homology informationregulation of chronic inflammatory response / CCR4 chemokine receptor binding / chemokine (C-C motif) ligand 5 signaling pathway / chemokine receptor antagonist activity / chemokine (C-C motif) ligand 5 binding / phospholipase D-activating G protein-coupled receptor signaling pathway / CCR1 chemokine receptor binding / positive regulation of natural killer cell chemotaxis / negative regulation of macrophage apoptotic process / negative regulation of T cell apoptotic process ...regulation of chronic inflammatory response / CCR4 chemokine receptor binding / chemokine (C-C motif) ligand 5 signaling pathway / chemokine receptor antagonist activity / chemokine (C-C motif) ligand 5 binding / phospholipase D-activating G protein-coupled receptor signaling pathway / CCR1 chemokine receptor binding / positive regulation of natural killer cell chemotaxis / negative regulation of macrophage apoptotic process / negative regulation of T cell apoptotic process / chemokine receptor binding / receptor signaling protein tyrosine kinase activator activity / CCR5 chemokine receptor binding / positive regulation of T cell apoptotic process / alkane catabolic process / positive regulation of receptor signaling pathway via STAT / positive regulation of T cell chemotaxis / CCR chemokine receptor binding / chemokine receptor activity / signaling / phosphatidylinositol-4,5-bisphosphate phospholipase C activity / neutrophil activation / positive regulation of homotypic cell-cell adhesion / positive regulation of cell-cell adhesion mediated by integrin / positive regulation of G protein-coupled receptor signaling pathway / regulation of T cell activation / C-C chemokine binding / positive regulation of calcium ion transport / response to cholesterol / eosinophil chemotaxis / C-C chemokine receptor activity / positive regulation of innate immune response / positive regulation of monocyte chemotaxis / cell surface receptor signaling pathway via STAT / macrophage chemotaxis / positive regulation of smooth muscle cell migration / chemokine activity / Chemokine receptors bind chemokines / negative regulation of viral genome replication / negative regulation of G protein-coupled receptor signaling pathway / release of sequestered calcium ion into cytosol by sarcoplasmic reticulum / positive regulation of neuroinflammatory response / dendritic cell chemotaxis / phospholipase activator activity / leukocyte cell-cell adhesion / exocytosis / positive regulation of macrophage chemotaxis / Interleukin-10 signaling / chemoattractant activity / regulation of insulin secretion / cellular response to interleukin-1 / host-mediated suppression of viral transcription / monocyte chemotaxis / Binding and entry of HIV virion / positive regulation of translational initiation / positive regulation of TOR signaling / positive regulation of T cell migration / cellular defense response / positive regulation of viral genome replication / coreceptor activity / positive regulation of T cell proliferation / cellular response to fibroblast growth factor stimulus / positive regulation of smooth muscle cell proliferation / positive regulation of cell adhesion / calcium-mediated signaling / chemokine-mediated signaling pathway / cellular response to tumor necrosis factor / cell chemotaxis / cellular response to virus / cellular response to type II interferon / response to toxic substance / response to virus / virus receptor activity / chemotaxis / intracellular calcium ion homeostasis / calcium ion transport / MAPK cascade / cell-cell signaling / cellular response to lipopolysaccharide / actin binding / positive regulation of cytosolic calcium ion concentration / antimicrobial humoral immune response mediated by antimicrobial peptide / positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction / G alpha (i) signalling events / electron transfer activity / protein kinase activity / cell surface receptor signaling pathway / endosome / inflammatory response / positive regulation of cell migration / immune response / iron ion binding / G protein-coupled receptor signaling pathway / external side of plasma membrane / cell surface / protein homodimerization activity / extracellular region / membrane / identical protein binding / plasma membrane Similarity search - Function | |||||||||
| Biological species | Homo sapiens (human) Clostridium pasteurianum (bacteria) | |||||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / molecular replacement / Resolution: 2.204 Å | |||||||||
Authors | Zheng, Y. / Qin, L. / Han, G.W. / Gustavsson, M. / Kawamura, T. / Stevens, R.C. / Cherezov, V. / Kufareva, I. / Handel, T.M. | |||||||||
| Funding support | United States, 1items
| |||||||||
Citation | Journal: Immunity / Year: 2017Title: Structure of CC Chemokine Receptor 5 with a Potent Chemokine Antagonist Reveals Mechanisms of Chemokine Recognition and Molecular Mimicry by HIV. Authors: Zheng, Y. / Han, G.W. / Abagyan, R. / Wu, B. / Stevens, R.C. / Cherezov, V. / Kufareva, I. / Handel, T.M. | |||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 5uiw.cif.gz | 189.9 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb5uiw.ent.gz | 149.1 KB | Display | PDB format |
| PDBx/mmJSON format | 5uiw.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/ui/5uiw ftp://data.pdbj.org/pub/pdb/validation_reports/ui/5uiw | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 4mbsS S: Starting model for refinement |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||
|---|---|---|---|---|---|---|---|---|---|
| 1 |
| ||||||||
| Unit cell |
|
-
Components
-Protein , 2 types, 2 molecules AB
| #1: Protein | Mass: 47158.828 Da / Num. of mol.: 1 / Mutation: C58Y, G163N, A233D, K303E Source method: isolated from a genetically manipulated source Details: Rubredoxin fusion sequence P00268; in between CCR5 residue 223 and 227 MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE Source: (gene. exp.) Homo sapiens (human), (gene. exp.) Clostridium pasteurianum (bacteria)Gene: CCR5, CMKBR5 / Plasmid: pfastbac-1 / Cell line (production host): sf9 / Organ (production host): Ovary / Production host: ![]() |
|---|---|
| #2: Protein | Mass: 8662.117 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: Sequence before CC motif "QGPPLMALQS" (where the first residue Q is PCA as glutamine is cyclized into pyroglutamic acid residue) is artificial to replace native sequence "SPYSSDTTP". As the ...Details: Sequence before CC motif "QGPPLMALQS" (where the first residue Q is PCA as glutamine is cyclized into pyroglutamic acid residue) is artificial to replace native sequence "SPYSSDTTP". As the register 0 for PCA, all the rest of residue numbers are consistent for chemokine residues. Source: (gene. exp.) Homo sapiens (human) / Gene: CCL5, D17S136E, SCYA5 / Plasmid: pfastbac-1 / Cell line (production host): sf9 / Production host: ![]() |
-Non-polymers , 4 types, 53 molecules 






| #3: Chemical | ChemComp-ZN / | ||||
|---|---|---|---|---|---|
| #4: Chemical | ChemComp-OLC / ( #5: Chemical | #6: Water | ChemComp-HOH / | |
-Details
| Has protein modification | Y |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.71 Å3/Da / Density % sol: 54.65 % |
|---|---|
| Crystal grow | Temperature: 295.5 K / Method: lipidic cubic phase / pH: 6.3 Details: 29% (v/v) PEG 400, 120 mM lithium citrate, 1.2% (w/v) 1,5-Diaminopentane dihydrochloride, 100 mM 2-(N-morpholino)ethanesulfonic acid |
-Data collection
| Diffraction | Mean temperature: 100 K | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Diffraction source | Source: SYNCHROTRON / Type: OTHER / Wavelength: 1.0332 Å | |||||||||||||||||||||||||||
| Detector | Type: PSI PILATUS 6M / Detector: PIXEL / Date: Jul 5, 2016 / Details: K-B pair of biomorph mirrors | |||||||||||||||||||||||||||
| Radiation | Monochromator: Double Crystal / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray | |||||||||||||||||||||||||||
| Radiation wavelength | Wavelength: 1.0332 Å / Relative weight: 1 | |||||||||||||||||||||||||||
| Reflection | Resolution: 2.18→29.472 Å / Num. obs: 32803 / % possible obs: 99.2 % / Redundancy: 13.7 % / Biso Wilson estimate: 28.07 Å2 / CC1/2: 0.999 / Rmerge(I) obs: 0.145 / Rpim(I) all: 0.039 / Rrim(I) all: 0.151 / Net I/av σ(I): 9.4 / Net I/σ(I): 9.4 | |||||||||||||||||||||||||||
| Reflection shell | Diffraction-ID: 1
|
-Phasing
| Phasing | Method: molecular replacement |
|---|
-
Processing
| Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 4MBS Resolution: 2.204→29.472 Å / SU ML: 0.27 / Cross valid method: FREE R-VALUE / σ(F): 1.97 / Phase error: 27.72
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso max: 109.87 Å2 / Biso mean: 42.3057 Å2 / Biso min: 5.5 Å2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: final / Resolution: 2.204→29.472 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell | Refine-ID: X-RAY DIFFRACTION / Rfactor Rfree error: 0 / Total num. of bins used: 9
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS params. | Method: refined / Refine-ID: X-RAY DIFFRACTION
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS group |
|
Movie
Controller
About Yorodumi



Homo sapiens (human)
Clostridium pasteurianum (bacteria)
X-RAY DIFFRACTION
United States, 1items
Citation








PDBj




















