[English] 日本語
Yorodumi- PDB-5nc1: Structure of the distal domain of mouse adenovirus 2 fibre bound ... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 5nc1 | ||||||
|---|---|---|---|---|---|---|---|
| Title | Structure of the distal domain of mouse adenovirus 2 fibre bound to N-acetyl-glucosamine | ||||||
Components | Fiber | ||||||
Keywords | VIRAL PROTEIN / Triple beta-spiral / 3-bladed propeller / ABCJ-GHID topology / N-acetyl-glucosamine binding | ||||||
| Function / homology | Function and homology informationadhesion receptor-mediated virion attachment to host cell / viral capsid / cell adhesion / symbiont entry into host cell / host cell nucleus Similarity search - Function | ||||||
| Biological species | Murine adenovirus 2 | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2 Å | ||||||
Authors | Singh, A.K. / van Raaij, M.J. | ||||||
Citation | Journal: J. Gen. Virol. / Year: 2018Title: Structure and N-acetylglucosamine binding of the distal domain of mouse adenovirus 2 fibre. Authors: Singh, A.K. / Nguyen, T.H. / Vidovszky, M.Z. / Harrach, B. / Benko, M. / Kirwan, A. / Joshi, L. / Kilcoyne, M. / Berbis, M.A. / Canada, F.J. / Jimenez-Barbero, J. / Menendez, M. / Wilson, S. ...Authors: Singh, A.K. / Nguyen, T.H. / Vidovszky, M.Z. / Harrach, B. / Benko, M. / Kirwan, A. / Joshi, L. / Kilcoyne, M. / Berbis, M.A. / Canada, F.J. / Jimenez-Barbero, J. / Menendez, M. / Wilson, S.S. / Bromme, B.A. / Smith, J.G. / van Raaij, M.J. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 5nc1.cif.gz | 138.8 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb5nc1.ent.gz | 107.5 KB | Display | PDB format |
| PDBx/mmJSON format | 5nc1.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/nc/5nc1 ftp://data.pdbj.org/pub/pdb/validation_reports/nc/5nc1 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 5n83C ![]() 5n8dC ![]() 5nbhSC C: citing same article ( S: Starting model for refinement |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| 1 |
| |||||||||
| Unit cell |
| |||||||||
| Components on special symmetry positions |
|
-
Components
| #1: Protein | Mass: 25810.922 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF is an expression and purification tag. GALTAQGAS residues are disordered. Source: (gene. exp.) Murine adenovirus 2 / Plasmid: pET28a / Production host: ![]() #2: Sugar | #3: Chemical | ChemComp-SO4 / #4: Chemical | ChemComp-GOL / | #5: Water | ChemComp-HOH / | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.35 Å3/Da / Density % sol: 47.62 % |
|---|---|
| Crystal grow | Temperature: 294 K / Method: vapor diffusion, sitting drop / pH: 7.5 Details: 1.125 M lithium sulphate, 0.075 M HEPES-NaOH, 25% (v/v) glycerol, 10 mM Tris-HCl |
-Data collection
| Diffraction | Mean temperature: 100 K |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: ESRF / Beamline: ID23-2 / Wavelength: 0.8729 Å |
| Detector | Type: MARMOSAIC 225 mm CCD / Detector: CCD / Date: Oct 31, 2014 |
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 0.8729 Å / Relative weight: 1 |
| Reflection | Resolution: 2→28.9 Å / Num. obs: 48930 / % possible obs: 100 % / Redundancy: 7.9 % / CC1/2: 0.998 / Rmerge(I) obs: 0.101 / Net I/σ(I): 13.2 |
| Reflection shell | Resolution: 2→2.05 Å / Redundancy: 7.8 % / Rmerge(I) obs: 0.404 / Mean I/σ(I) obs: 4.8 / Num. unique obs: 3642 / CC1/2: 0.714 / % possible all: 100 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 5NBH Resolution: 2→28 Å / Cor.coef. Fo:Fc: 0.965 / Cor.coef. Fo:Fc free: 0.944 / SU B: 3.794 / SU ML: 0.102 / Cross valid method: THROUGHOUT / ESU R: 0.147 / ESU R Free: 0.137 / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 28.478 Å2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: 1 / Resolution: 2→28 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi



Murine adenovirus 2
X-RAY DIFFRACTION
Citation










PDBj






