[English] 日本語
Yorodumi
- PDB-5n83: Structure of the distal domain of mouse adenovirus 2 fibre, methy... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 5n83
TitleStructure of the distal domain of mouse adenovirus 2 fibre, methylmercury chloride derivative
ComponentsFiber
KeywordsSTRUCTURAL PROTEIN / Triple beta-spiral / 3-bladed propeller / ABCJ-GHID topology / N-acetyl-glucosamine binding
Function / homology
Function and homology information


adhesion receptor-mediated virion attachment to host cell / virion component / cell adhesion / symbiont entry into host cell
Similarity search - Function
Adenoviral fibre protein, repeat/shaft region / Adenoviral fibre protein (repeat/shaft region) / Adenovirus fibre protein / Attachment protein shaft domain superfamily
Similarity search - Domain/homology
Biological speciesMurine adenovirus 2
MethodX-RAY DIFFRACTION / SYNCHROTRON / SAD / Resolution: 2.76 Å
AuthorsSingh, A.K. / van Raaij, M.J.
Funding support Spain, 4items
OrganizationGrant numberCountry
Spanish Ministry of Economy and CompetitivenessBFU2011-24843 Spain
Spanish Ministry of Economy and CompetitivenessBFU2014-53425-P Spain
Spanish Ministry of Economy and CompetitivenessBIO2015-68990-REDT Spain
Spanish Ministry of Economy and CompetitivenessFIS2011-16090-E Spain
CitationJournal: J. Gen. Virol. / Year: 2018
Title: Structure and N-acetylglucosamine binding of the distal domain of mouse adenovirus 2 fibre.
Authors: Singh, A.K. / Nguyen, T.H. / Vidovszky, M.Z. / Harrach, B. / Benko, M. / Kirwan, A. / Joshi, L. / Kilcoyne, M. / Berbis, M.A. / Canada, F.J. / Jimenez-Barbero, J. / Menendez, M. / Wilson, S. ...Authors: Singh, A.K. / Nguyen, T.H. / Vidovszky, M.Z. / Harrach, B. / Benko, M. / Kirwan, A. / Joshi, L. / Kilcoyne, M. / Berbis, M.A. / Canada, F.J. / Jimenez-Barbero, J. / Menendez, M. / Wilson, S.S. / Bromme, B.A. / Smith, J.G. / van Raaij, M.J.
History
DepositionFeb 22, 2017Deposition site: PDBE / Processing site: PDBE
Revision 1.0Mar 14, 2018Provider: repository / Type: Initial release
Revision 1.1Oct 10, 2018Group: Data collection / Database references / Structure summary
Category: citation / citation_author / entity
Item: _citation.country / _citation.journal_abbrev ..._citation.country / _citation.journal_abbrev / _citation.journal_id_ASTM / _citation.journal_id_CSD / _citation.journal_id_ISSN / _citation.pdbx_database_id_DOI / _citation.pdbx_database_id_PubMed / _citation.title / _citation.year / _citation_author.name / _entity.formula_weight
Revision 1.2Nov 14, 2018Group: Data collection / Database references / Structure summary
Category: citation / entity
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _entity.formula_weight
Revision 1.3May 8, 2024Group: Data collection / Database references / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / struct_ncs_dom_lim
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession ..._database_2.pdbx_DOI / _database_2.pdbx_database_accession / _struct_ncs_dom_lim.beg_auth_comp_id / _struct_ncs_dom_lim.beg_label_asym_id / _struct_ncs_dom_lim.beg_label_comp_id / _struct_ncs_dom_lim.beg_label_seq_id / _struct_ncs_dom_lim.end_auth_comp_id / _struct_ncs_dom_lim.end_label_asym_id / _struct_ncs_dom_lim.end_label_comp_id / _struct_ncs_dom_lim.end_label_seq_id

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Fiber
B: Fiber
C: Fiber
hetero molecules


Theoretical massNumber of molelcules
Total (without water)78,4368
Polymers77,4333
Non-polymers1,0035
Water79344
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area10980 Å2
ΔGint-112 kcal/mol
Surface area22690 Å2
MethodPISA
Unit cell
Length a, b, c (Å)92.116, 164.285, 96.432
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number20
Space group name H-MC2221
Noncrystallographic symmetry (NCS)NCS domain:
IDEns-IDDetails
11A
21B
12A
22C
13B
23C

NCS domain segments:

Component-ID: _ / End auth comp-ID: ILE / End label comp-ID: ILE / Refine code: _

Dom-IDEns-IDBeg auth comp-IDBeg label comp-IDAuth asym-IDLabel asym-IDAuth seq-IDLabel seq-ID
11SERSERAA594 - 78644 - 236
21SERSERBB594 - 78644 - 236
12SERSERAA594 - 78644 - 236
22SERSERCC594 - 78644 - 236
13ALAALABB593 - 78643 - 236
23ALAALACC593 - 78643 - 236

NCS ensembles :
ID
1
2
3

-
Components

#1: Protein Fiber


Mass: 25810.922 Da / Num. of mol.: 3
Source method: isolated from a genetically manipulated source
Details: GSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF is an expression and purification tag that could not be modelled in any chain because no electron density was visible for it. GALTAQGA of chain A, GALTAQG ...Details: GSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF is an expression and purification tag that could not be modelled in any chain because no electron density was visible for it. GALTAQGA of chain A, GALTAQG of chain B and GALTAQ of chain C are disordered and could not be modelled either.
Source: (gene. exp.) Murine adenovirus 2 / Production host: Escherichia coli BL21(DE3) (bacteria) / References: UniProt: E7CH51
#2: Chemical
ChemComp-HG / MERCURY (II) ION


Mass: 200.590 Da / Num. of mol.: 5 / Source method: obtained synthetically / Formula: Hg
#3: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 44 / Source method: isolated from a natural source / Formula: H2O

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.82 Å3/Da / Density % sol: 56.36 % / Description: Plate
Crystal growTemperature: 294 K / Method: vapor diffusion, sitting drop / pH: 7.5
Details: 4.0 M ammonium formate, 0.1 M HEPES-NaOH, 3 mM methylmercury chloride, 10 mM Tris-HCl

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: ALBA / Beamline: XALOC / Wavelength: 1.0024 Å
DetectorType: DECTRIS PILATUS 6M / Detector: PIXEL / Date: Jan 31, 2014
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1.0024 Å / Relative weight: 1
ReflectionResolution: 2.76→96.4 Å / Num. obs: 19199 / % possible obs: 99.7 % / Redundancy: 11.7 % / Biso Wilson estimate: 71.3 Å2 / CC1/2: 0.998 / Rmerge(I) obs: 0.104 / Net I/σ(I): 19.6
Reflection shellResolution: 2.76→3.02 Å / Redundancy: 8 % / Rmerge(I) obs: 0.589 / Mean I/σ(I) obs: 3.2 / Num. unique obs: 4473 / CC1/2: 0.867 / % possible all: 98.8

-
Processing

Software
NameVersionClassification
REFMAC5.8.0158refinement
XDSdata reduction
Aimlessdata scaling
autoSHARPphasing
Cootmodel building
RefinementMethod to determine structure: SAD / Resolution: 2.76→82.14 Å / Cor.coef. Fo:Fc: 0.936 / Cor.coef. Fo:Fc free: 0.916 / SU B: 15.07 / SU ML: 0.289 / Cross valid method: THROUGHOUT / ESU R Free: 0.35 / Stereochemistry target values: MAXIMUM LIKELIHOOD / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
RfactorNum. reflection% reflectionSelection details
Rfree0.24824 985 5.1 %RANDOM
Rwork0.20272 ---
obs0.20507 18197 99.64 %-
Solvent computationIon probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK
Displacement parametersBiso mean: 60.004 Å2
Baniso -1Baniso -2Baniso -3
1--1.5 Å20 Å20 Å2
2--2.41 Å20 Å2
3----0.91 Å2
Refinement stepCycle: 1 / Resolution: 2.76→82.14 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms4529 0 5 44 4578
Refine LS restraints
Refine-IDTypeDev idealDev ideal targetNumber
X-RAY DIFFRACTIONr_bond_refined_d0.0090.024634
X-RAY DIFFRACTIONr_bond_other_d0.0020.024105
X-RAY DIFFRACTIONr_angle_refined_deg1.461.9546298
X-RAY DIFFRACTIONr_angle_other_deg0.93139545
X-RAY DIFFRACTIONr_dihedral_angle_1_deg7.265582
X-RAY DIFFRACTIONr_dihedral_angle_2_deg36.94823.939198
X-RAY DIFFRACTIONr_dihedral_angle_3_deg18.09315732
X-RAY DIFFRACTIONr_dihedral_angle_4_deg18.041521
X-RAY DIFFRACTIONr_chiral_restr0.0970.2710
X-RAY DIFFRACTIONr_gen_planes_refined0.0050.0215199
X-RAY DIFFRACTIONr_gen_planes_other0.0010.02990
X-RAY DIFFRACTIONr_nbd_refined
X-RAY DIFFRACTIONr_nbd_other
X-RAY DIFFRACTIONr_nbtor_refined
X-RAY DIFFRACTIONr_nbtor_other
X-RAY DIFFRACTIONr_xyhbond_nbd_refined
X-RAY DIFFRACTIONr_xyhbond_nbd_other
X-RAY DIFFRACTIONr_metal_ion_refined
X-RAY DIFFRACTIONr_metal_ion_other
X-RAY DIFFRACTIONr_symmetry_vdw_refined
X-RAY DIFFRACTIONr_symmetry_vdw_other
X-RAY DIFFRACTIONr_symmetry_hbond_refined
X-RAY DIFFRACTIONr_symmetry_hbond_other
X-RAY DIFFRACTIONr_symmetry_metal_ion_refined
X-RAY DIFFRACTIONr_symmetry_metal_ion_other
X-RAY DIFFRACTIONr_mcbond_it3.6336.0872337
X-RAY DIFFRACTIONr_mcbond_other3.6346.0852336
X-RAY DIFFRACTIONr_mcangle_it6.1919.1182916
X-RAY DIFFRACTIONr_mcangle_other6.199.1192917
X-RAY DIFFRACTIONr_scbond_it3.2846.3492296
X-RAY DIFFRACTIONr_scbond_other3.2836.3492296
X-RAY DIFFRACTIONr_scangle_it
X-RAY DIFFRACTIONr_scangle_other5.5419.3933382
X-RAY DIFFRACTIONr_long_range_B_refined9.51970.1614761
X-RAY DIFFRACTIONr_long_range_B_other9.51970.1784761
X-RAY DIFFRACTIONr_rigid_bond_restr
X-RAY DIFFRACTIONr_sphericity_free
X-RAY DIFFRACTIONr_sphericity_bonded
Refine LS restraints NCS

Refine-ID: X-RAY DIFFRACTION / Type: interatomic distance / Weight position: 0.05

Ens-IDDom-IDAuth asym-IDNumberRms dev position (Å)
11A111020.1
12B111020.1
21A110020.11
22C110020.11
31B110220.1
32C110220.1
LS refinement shellResolution: 2.757→2.829 Å / Total num. of bins used: 20
RfactorNum. reflection% reflection
Rfree0.377 69 -
Rwork0.327 1269 -
obs--96.82 %

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbjlvh1.pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more