[English] 日本語
![](img/lk-miru.gif)
- PDB-5n76: Crystal structure of the apo-form of the CO dehydrogenase accesso... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 5n76 | ||||||
---|---|---|---|---|---|---|---|
Title | Crystal structure of the apo-form of the CO dehydrogenase accessory protein CooT from Rhodospirillum rubrum | ||||||
![]() | CooT | ||||||
![]() | nickel-binding protein / CODH maturation / anaerobic metabolism | ||||||
Function / homology | CO dehydrogenase accessory protein CooT / CO dehydrogenase accessory protein CooT / CooT![]() | ||||||
Biological species | ![]() | ||||||
Method | ![]() ![]() ![]() | ||||||
![]() | Timm, J. / Brochier-Armanet, C. / Perard, J. / Zambelli, B. / Ollagnier-de-Choudens, S. / Ciurli, S. / Cavazza, C. | ||||||
Funding support | ![]()
| ||||||
![]() | ![]() Title: The CO dehydrogenase accessory protein CooT is a novel nickel-binding protein. Authors: Timm, J. / Brochier-Armanet, C. / Perard, J. / Zambelli, B. / Ollagnier-de-Choudens, S. / Ciurli, S. / Cavazza, C. | ||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 82.6 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 67.1 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Arichive directory | ![]() ![]() | HTTPS FTP |
---|
-Related structure data
Similar structure data |
---|
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||
---|---|---|---|---|---|---|---|---|---|
1 | ![]()
| ||||||||
2 | ![]()
| ||||||||
3 | ![]()
| ||||||||
Unit cell |
|
-
Components
#1: Protein | Mass: 7105.162 Da / Num. of mol.: 6 Source method: isolated from a genetically manipulated source Details: MCMAKVVLTKADGGRVEIGDVLEVRAEGGAVRVTTLFDEEHAFPGLAIGRVDLRSGVISL IEEQNR Source: (gene. exp.) ![]() ![]() ![]() #2: Water | ChemComp-HOH / | |
---|
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 3.85 Å3/Da / Density % sol: 68.08 % |
---|---|
Crystal grow | Temperature: 293 K / Method: vapor diffusion, hanging drop / pH: 4.6 Details: 50 mM sodium acetate pH 4.6, 100 mM CaCl2 and 16% (v/v) 2-propanol |
-Data collection
Diffraction | Mean temperature: 100 K |
---|---|
Diffraction source | Source: ![]() ![]() ![]() |
Detector | Type: ADSC QUANTUM 315r / Detector: CCD / Date: Feb 6, 2016 |
Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
Radiation wavelength | Wavelength: 0.987 Å / Relative weight: 1 |
Reflection | Resolution: 1.9→44.59 Å / Num. obs: 52618 / % possible obs: 99.2 % / Redundancy: 7.26 % / Net I/σ(I): 10.84 |
-
Processing
Software |
| ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]()
| ||||||||||||
Refinement step | Cycle: LAST / Resolution: 1.9→44.59 Å
|