+
Open data
-
Basic information
| Entry | Database: PDB / ID: 4zc4 | ||||||
|---|---|---|---|---|---|---|---|
| Title | Crystal structure of LARP1-unique domain DM15 | ||||||
Components | La-related protein 1 | ||||||
Keywords | RNA BINDING PROTEIN / RNA-binding / Heat-like / mRNA / helical repeat | ||||||
| Function / homology | Function and homology informationcellular response to rapamycin / translation activator activity / eukaryotic initiation factor 4E binding / RNA cap binding / response to amino acid starvation / TORC1 signaling / RNA 7-methylguanosine cap binding / mRNA stabilization / post-transcriptional regulation of gene expression / TOR signaling ...cellular response to rapamycin / translation activator activity / eukaryotic initiation factor 4E binding / RNA cap binding / response to amino acid starvation / TORC1 signaling / RNA 7-methylguanosine cap binding / mRNA stabilization / post-transcriptional regulation of gene expression / TOR signaling / ribosomal small subunit binding / positive regulation of translational initiation / positive regulation of macroautophagy / positive regulation of viral genome replication / translation initiation factor binding / negative regulation of translational initiation / positive regulation of translation / mRNA 3'-UTR binding / translational initiation / mRNA 5'-UTR binding / cytoplasmic stress granule / cell population proliferation / negative regulation of translation / cadherin binding / SARS-CoV-2 activates/modulates innate and adaptive immune responses / RNA binding / membrane / cytosol / cytoplasm Similarity search - Function | ||||||
| Biological species | Homo sapiens (human) | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MAD / Resolution: 1.86 Å | ||||||
Authors | Lahr, R.M. / Berman, A.J. | ||||||
Citation | Journal: Nucleic Acids Res. / Year: 2015Title: The La-related protein 1-specific domain repurposes HEAT-like repeats to directly bind a 5'TOP sequence. Authors: Lahr, R.M. / Mack, S.M. / Heroux, A. / Blagden, S.P. / Bousquet-Antonelli, C. / Deragon, J.M. / Berman, A.J. #1: Journal: To Be PublishedTitle: The LARP1-specific domain DM15 repurposes HEAT-like repeats to directly bind messenger RNA Authors: Lahr, R.M. / Mack, S.M. / Heroux, A. / Blagden, S.P. / Bousquet-Antonelli, C. / Deragon, J.M. / Berman, A.J. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 4zc4.cif.gz | 146.9 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb4zc4.ent.gz | 116 KB | Display | PDB format |
| PDBx/mmJSON format | 4zc4.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Summary document | 4zc4_validation.pdf.gz | 462.2 KB | Display | wwPDB validaton report |
|---|---|---|---|---|
| Full document | 4zc4_full_validation.pdf.gz | 465.2 KB | Display | |
| Data in XML | 4zc4_validation.xml.gz | 27.2 KB | Display | |
| Data in CIF | 4zc4_validation.cif.gz | 39.9 KB | Display | |
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/zc/4zc4 ftp://data.pdbj.org/pub/pdb/validation_reports/zc/4zc4 | HTTPS FTP |
-Related structure data
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||
|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||
| 2 | ![]()
| ||||||||
| Unit cell |
|
-
Components
| #1: Protein | Mass: 19616.281 Da / Num. of mol.: 4 / Fragment: UNP residues 873-1023 Source method: isolated from a genetically manipulated source Details: QHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFR Source: (gene. exp.) Homo sapiens (human) / Gene: LARP1, KIAA0731, LARP / Production host: ![]() #2: Chemical | #3: Water | ChemComp-HOH / | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.41 Å3/Da / Density % sol: 49 % |
|---|---|
| Crystal grow | Temperature: 304 K / Method: vapor diffusion, hanging drop / pH: 6.3 / Details: 0.225 M ammonium chloride, pH 6.3, 23% PEG 3350 / Temp details: Room Temp |
-Data collection
| Diffraction | Mean temperature: 80 K |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: NSLS / Beamline: X25 / Wavelength: 1.1 Å |
| Detector | Type: PSI PILATUS 6M / Detector: PIXEL / Date: Apr 16, 2013 |
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 1.1 Å / Relative weight: 1 |
| Reflection | Resolution: 1.62→76.57 Å / Num. obs: 87993 / % possible obs: 95 % / Redundancy: 5.4 % / Rmerge(I) obs: 0.153 / Net I/σ(I): 34.582 |
| Reflection shell | Highest resolution: 1.62 Å / Redundancy: 2.4 % / Rmerge(I) obs: 0.108 / Mean I/σ(I) obs: 1.4 / % possible all: 63.66 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MAD / Resolution: 1.86→38.285 Å / SU ML: 0.2 / Cross valid method: FREE R-VALUE / σ(F): 1.34 / Phase error: 24.54 / Stereochemistry target values: ML
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 1.86→38.285 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell |
|
Movie
Controller
About Yorodumi




Homo sapiens (human)
X-RAY DIFFRACTION
Citation










PDBj







