[English] 日本語
Yorodumi
- PDB-3f1y: Mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 3f1y
TitleMannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus
ComponentsMannosyl-3-phosphoglycerate synthase
KeywordsTRANSFERASE / GT-A type glycosyltransferase / GT-81 / mannosyl-3-phosphoglycerate synthase / Rubrobacter xylanophilus / GDP-mannose
Function / homology
Function and homology information


mannosyl-3-phosphoglycerate synthase activity / glucosyl-3-phosphoglycerate synthase / metal ion binding
Similarity search - Function
Glycosyltransferase 2-like / Glycosyl transferase family 2 / Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A / Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A / Nucleotide-diphospho-sugar transferases / Alpha-Beta Complex / Alpha Beta
Similarity search - Domain/homology
Glucosyl-3-phosphoglycerate synthase
Similarity search - Component
Biological speciessynthetic construct (others)
Rubrobacter xylanophilus (bacteria)
MethodX-RAY DIFFRACTION / SYNCHROTRON / SIRAS / Resolution: 2.2 Å
AuthorsMacedo-Ribeiro, S. / Pereira, P.J.B. / Empadinhas, N. / da Costa, M.S.
Citation
Journal: Mol.Microbiol. / Year: 2011
Title: Functional and structural characterization of a novel mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus reveals its dual substrate specificity
Authors: Empadinhas, N. / Pereira, P.J.B. / Albuquerque, L. / Costa, J. / Sa-Moura, B. / Marques, A.T. / Macedo-Ribeiro, S. / da Costa, M.S.
#1: Journal: Acta Crystallogr.,Sect.F / Year: 2008
Title: Crystallization and preliminary crystallographic analysis of mannosyl-3-phosphoglycerate synthase from Rubrobacter xylanophilus
Authors: Sa-Moura, B. / Albuquerque, L. / Empadinhas, N. / da Costa, M.S. / Pereira, P.J. / Macedo-Ribeiro, S.
History
DepositionOct 28, 2008Deposition site: RCSB / Processing site: PDBJ
Revision 1.0Nov 3, 2009Provider: repository / Type: Initial release
Revision 1.1Jul 13, 2011Group: Version format compliance
Revision 1.2Jun 28, 2017Group: Source and taxonomy / Category: entity_src_gen
Revision 1.3Dec 27, 2023Group: Advisory / Data collection ...Advisory / Data collection / Database references / Derived calculations
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_struct_conn_angle / pdbx_unobs_or_zero_occ_atoms / struct_conn / struct_ref_seq / struct_site
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession ..._database_2.pdbx_DOI / _database_2.pdbx_database_accession / _pdbx_struct_conn_angle.ptnr1_auth_asym_id / _pdbx_struct_conn_angle.ptnr1_auth_comp_id / _pdbx_struct_conn_angle.ptnr1_auth_seq_id / _pdbx_struct_conn_angle.ptnr1_label_asym_id / _pdbx_struct_conn_angle.ptnr1_label_comp_id / _pdbx_struct_conn_angle.ptnr1_label_seq_id / _pdbx_struct_conn_angle.ptnr3_auth_asym_id / _pdbx_struct_conn_angle.ptnr3_auth_comp_id / _pdbx_struct_conn_angle.ptnr3_auth_seq_id / _pdbx_struct_conn_angle.ptnr3_label_asym_id / _pdbx_struct_conn_angle.ptnr3_label_comp_id / _pdbx_struct_conn_angle.ptnr3_label_seq_id / _pdbx_struct_conn_angle.value / _struct_conn.pdbx_dist_value / _struct_conn.ptnr1_auth_asym_id / _struct_conn.ptnr1_auth_comp_id / _struct_conn.ptnr1_auth_seq_id / _struct_conn.ptnr1_label_asym_id / _struct_conn.ptnr1_label_atom_id / _struct_conn.ptnr1_label_comp_id / _struct_conn.ptnr1_label_seq_id / _struct_conn.ptnr2_auth_asym_id / _struct_conn.ptnr2_auth_comp_id / _struct_conn.ptnr2_auth_seq_id / _struct_conn.ptnr2_label_asym_id / _struct_conn.ptnr2_label_atom_id / _struct_conn.ptnr2_label_comp_id / _struct_ref_seq.db_align_beg / _struct_ref_seq.db_align_end / _struct_site.pdbx_auth_asym_id / _struct_site.pdbx_auth_comp_id / _struct_site.pdbx_auth_seq_id

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Mannosyl-3-phosphoglycerate synthase
C: Mannosyl-3-phosphoglycerate synthase
hetero molecules


Theoretical massNumber of molelcules
Total (without water)86,2858
Polymers86,0952
Non-polymers1906
Water7,638424
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area6990 Å2
ΔGint-107 kcal/mol
Surface area23650 Å2
MethodPISA
Unit cell
Length a, b, c (Å)108.881, 108.881, 311.651
Angle α, β, γ (deg.)90.00, 90.00, 120.00
Int Tables number179
Space group name H-MP6522

-
Components

#1: Protein Mannosyl-3-phosphoglycerate synthase / mannosyl/glucosyl-3-phosphoglycerate synthase


Mass: 43047.438 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) synthetic construct (others), (gene. exp.) Rubrobacter xylanophilus (bacteria)
Strain: DSM 9941 / Gene: mpgS / Plasmid: pET30a / Production host: Escherichia coli (E. coli) / Strain (production host): BL21
References: UniProt: B7SY86, mannosyl-3-phosphoglycerate synthase
#2: Chemical ChemComp-MG / MAGNESIUM ION


Mass: 24.305 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: Mg
#3: Chemical
ChemComp-CL / CHLORIDE ION


Mass: 35.453 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: Cl
#4: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 424 / Source method: isolated from a natural source / Formula: H2O
Sequence detailsTHE N-TERMINAL SEQUENCE MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF CORRESPONDS TO THE ...THE N-TERMINAL SEQUENCE MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF CORRESPONDS TO THE EXPRESSION TAG AND LINKER.

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 3.1 Å3/Da / Density % sol: 60.28 %
Crystal growTemperature: 293 K / Method: vapor diffusion, hanging drop / pH: 6
Details: 100mM MES, 2M NaCl, 100mM NaH2PO4, 100mM KH2PO4, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: ESRF / Beamline: ID14-3 / Wavelength: 0.931 Å
DetectorType: ADSC QUANTUM 4 / Detector: CCD / Date: Jun 15, 2007
RadiationMonochromator: Diamond (111), Ge(220) / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.931 Å / Relative weight: 1
ReflectionResolution: 2.2→77.8 Å / Num. all: 56613 / Num. obs: 56613 / % possible obs: 100 % / Observed criterion σ(F): 0 / Observed criterion σ(I): 0 / Redundancy: 30.4 % / Biso Wilson estimate: 41.41 Å2 / Rmerge(I) obs: 0.068 / Rsym value: 0.068 / Net I/σ(I): 7.9
Reflection shellResolution: 2.2→2.32 Å / Redundancy: 18.3 % / Rmerge(I) obs: 0.604 / Mean I/σ(I) obs: 1.2 / Num. unique all: 8094 / Rsym value: 0.604 / % possible all: 100

-
Processing

Software
NameVersionClassificationNB
PHENIXrefinement
PDB_EXTRACT3.006data extraction
DNAdata collection
MOSFLMdata reduction
SCALAdata scaling
SHARPphasing
RefinementMethod to determine structure: SIRAS / Resolution: 2.2→51.394 Å / Occupancy max: 1 / Occupancy min: 0 / SU ML: 0.28 / Isotropic thermal model: Overall / Cross valid method: THROUGHOUT / σ(F): 0.01 / Phase error: 23.24 / Stereochemistry target values: ML
RfactorNum. reflection% reflectionSelection details
Rfree0.218 2711 5.08 %Random
Rwork0.188 50674 --
obs0.1895 53385 94.6 %-
all-53385 --
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL / Bsol: 64.555 Å2 / ksol: 0.361 e/Å3
Displacement parametersBiso max: 134.56 Å2 / Biso mean: 56.755 Å2 / Biso min: 33.05 Å2
Baniso -1Baniso -2Baniso -3
1-9.621 Å20 Å2-0 Å2
2--9.621 Å20 Å2
3----19.242 Å2
Refine analyzeLuzzati d res low obs: 51.4 Å / Luzzati sigma a obs: 0.2793 Å
Refinement stepCycle: LAST / Resolution: 2.2→51.394 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms4935 0 6 424 5365
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.0135035
X-RAY DIFFRACTIONf_angle_d1.4066830
X-RAY DIFFRACTIONf_dihedral_angle_d18.1761848
X-RAY DIFFRACTIONf_chiral_restr0.097749
X-RAY DIFFRACTIONf_plane_restr0.006914
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
2.2001-2.24010.30341350.25482265X-RAY DIFFRACTION83
2.2401-2.28320.23621220.23112350X-RAY DIFFRACTION85
2.2832-2.32980.27591330.24092378X-RAY DIFFRACTION86
2.3298-2.38040.26041110.21842456X-RAY DIFFRACTION88
2.3804-2.43580.22961620.20432511X-RAY DIFFRACTION92
2.4358-2.49670.25991510.20312524X-RAY DIFFRACTION92
2.4967-2.56420.29481420.21622576X-RAY DIFFRACTION94
2.5642-2.63970.25091260.21522631X-RAY DIFFRACTION93
2.6397-2.72490.26751490.21632639X-RAY DIFFRACTION95
2.7249-2.82230.22721210.21362696X-RAY DIFFRACTION97
2.8223-2.93520.25631360.21312738X-RAY DIFFRACTION97
2.9352-3.06880.26181390.21232748X-RAY DIFFRACTION98
3.0688-3.23060.22991480.20122779X-RAY DIFFRACTION99
3.2306-3.4330.21621590.1922790X-RAY DIFFRACTION99
3.433-3.69790.21231370.16422828X-RAY DIFFRACTION99
3.6979-4.06990.17731420.15222839X-RAY DIFFRACTION99
4.0699-4.65850.16471500.13872887X-RAY DIFFRACTION100
4.6585-5.86790.19311750.16852912X-RAY DIFFRACTION100
5.8679-51.40810.20841730.18853127X-RAY DIFFRACTION100
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
11.4666-0.4837-0.80192.6630.4671.97520.06560.12830.1447-0.2429-0.06620.0976-0.572-0.3754-00.42060.2139-0.04320.5148-0.03960.3725-112.297177.19542.1597
20.59220.026-0.45583.26180.48641.18890.02610.0313-0.11920.0616-0.0945-0.0018-0.56970.0106-00.36650.1306-0.03060.6297-0.05970.3973-109.230271.7172.1838
30.9298-1.2699-0.39661.95730.89221.96210.03050.033-0.061-0.17730.0001-0.0952-0.3381-0.073900.34220.0517-0.01790.5386-0.06360.3765-101.47762.7896-3.3454
41.2403-0.4472-1.18020.52470.20510.7946-0.0891-0.53080.02410.09930.17030.05970.06830.2151-00.25850.0586-0.01550.6385-0.10290.4335-91.048653.4737.4249
52.9393-0.4656-0.17571.48910.6391.86130.052-0.11050.3251-0.14-0.028-0.2319-0.35010.218400.2823-0.14040.02060.4652-0.10060.4751-61.513157.7503-14.5362
61.05990.4895-0.47141.41610.47851.26650.03560.08670.1433-0.1844-0.0847-0.0732-0.42470.0546-00.3129-0.0177-0.00820.5656-0.10070.4877-68.013656.0422-15.48
72.3041-0.3514-0.58760.6114-0.00090.78830.12440.00790.0289-0.1331-0.0313-0.0275-0.19680.034200.2838-0.02340.01720.5295-0.09610.4305-78.657755.4662-9.9118
81.3995-1.0889-0.3241-0.78650.24030.69140.09790.313-0.2594-0.2094-0.0709-0.1104-0.1594-0.2093-00.4090.02850.01050.6512-0.09910.4899-93.548853.5701-19.2026
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection detailsAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1(chain A and resid 10:103)A10 - 103
2X-RAY DIFFRACTION2(chain A and resid 104:178)A104 - 178
3X-RAY DIFFRACTION3(chain A and resid 179:285)A179 - 285
4X-RAY DIFFRACTION4(chain A and resid 286:334)A286 - 334
5X-RAY DIFFRACTION5(chain C and resid 9:102)C9 - 102
6X-RAY DIFFRACTION6(chain C and resid 103:180)C103 - 180
7X-RAY DIFFRACTION7(chain C and resid 181:278)C181 - 278
8X-RAY DIFFRACTION8(chain C and resid 279:333)C279 - 333

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbjlvh1.pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more