[English] 日本語
![](img/lk-miru.gif)
- PDB-2cwb: Solution Structure of the Ubiquitin-Associated Domain of Human BM... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 2cwb | ||||||
---|---|---|---|---|---|---|---|
Title | Solution Structure of the Ubiquitin-Associated Domain of Human BMSC-UbP and its Complex with Ubiquitin | ||||||
![]() | Immunoglobulin G-binding protein G,Ubiquitin-like protein 7 | ||||||
![]() | PROTEIN BINDING / HELICAL BUNDLE | ||||||
Function / homology | ![]() IgG binding / polyubiquitin modification-dependent protein binding / ubiquitin-dependent protein catabolic process / defense response to virus / molecular adaptor activity / innate immune response / extracellular region / cytoplasm / cytosol Similarity search - Function | ||||||
Biological species | ![]() ![]() | ||||||
Method | SOLUTION NMR / torsion angle dynamics | ||||||
![]() | Chang, Y.G. / Song, A.X. / Gao, Y.G. / Shi, Y.H. / Lin, X.J. / Cao, X.T. / Lin, D.H. / Hu, H.Y. | ||||||
![]() | ![]() Title: Solution structure of the ubiquitin-associated domain of human BMSC-UbP and its complex with ubiquitin. Authors: Chang, Y.G. / Song, A.X. / Gao, Y.G. / Shi, Y.H. / Lin, X.J. / Cao, X.T. / Lin, D.H. / Hu, H.Y. | ||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 156.2 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 125.7 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 351.6 KB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 419.1 KB | Display | |
Data in XML | ![]() | 9.3 KB | Display | |
Data in CIF | ![]() | 14.5 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
-
Links
-
Assembly
Deposited unit | ![]()
| |||||||||
---|---|---|---|---|---|---|---|---|---|---|
1 |
| |||||||||
NMR ensembles |
|
-
Components
#1: Antibody | Mass: 11908.023 Da / Num. of mol.: 1 / Fragment: C-TERMINAL UBA DOMAIN,C-TERMINAL UBA DOMAIN / Mutation: I12A Source method: isolated from a genetically manipulated source Details: A solubility-enhancement tag (SET) GB1, immunoglobulin G binding domain 1 of Streptococcal protein G, was used to enhance the solubility of the UBA domain of BMSC-UbP. The sequence of the ...Details: A solubility-enhancement tag (SET) GB1, immunoglobulin G binding domain 1 of Streptococcal protein G, was used to enhance the solubility of the UBA domain of BMSC-UbP. The sequence of the chimerical HGB1-UBA is as follows:MHHHHHHQYKLALNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP.,A solubility-enhancement tag (SET) GB1, immunoglobulin G binding domain 1 of Streptococcal protein G, was used to enhance the solubility of the UBA domain of BMSC-UbP. The sequence of the chimerical HGB1-UBA is as follows:MHHHHHHQYKLALNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEGSQWQPQLQQLRDMGIQDDELSLRALQATGGDIQAALELIFAGGAP. Source: (gene. exp.) ![]() ![]() Genus: Streptococcus, Homo / Species: , / Gene: spg, UBL7, BMSCUBP, SB132 / Plasmid: pHGB / Species (production host): Escherichia coli / Production host: ![]() ![]() |
---|
-Experimental details
-Experiment
Experiment | Method: SOLUTION NMR | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
NMR experiment |
| ||||||||||||
NMR details | Text: The structure was determined using triple-resonance NMR spectroscopy. |
-
Sample preparation
Details | Contents: 1mM HGB1-UBA U-15N,13C; 20mM phosphate buffer; 90% H2O, 10% D2O Solvent system: 90% H2O/10% D2O |
---|---|
Sample conditions | Ionic strength: 100mM NaCl / pH: 6.5 / Pressure: ambient / Temperature: 298 K |
-NMR measurement
NMR spectrometer | Type: Varian INOVA / Manufacturer: Varian / Model: INOVA / Field strength: 600 MHz |
---|
-
Processing
NMR software |
| ||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method: torsion angle dynamics / Software ordinal: 1 | ||||||||||||||||||||
NMR representative | Selection criteria: closest to the average | ||||||||||||||||||||
NMR ensemble | Conformer selection criteria: structures with the lowest energy Conformers calculated total number: 200 / Conformers submitted total number: 10 |