[English] 日本語
Yorodumi- PDB-7kzt: Structure of the human fanconi anaemia Core-UBE2T-ID-DNA complex ... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7kzt | ||||||
|---|---|---|---|---|---|---|---|
| Title | Structure of the human fanconi anaemia Core-UBE2T-ID-DNA complex in intermediate state | ||||||
Components |
| ||||||
Keywords | LIGASE/DNA / Complex / LIGASE / LIGASE-DNA complex | ||||||
| Function / homology | Function and homology informationregulation of germ cell proliferation / regulation of CD40 signaling pathway / Fanconi anaemia nuclear complex / protein K29-linked ubiquitination / protein K27-linked ubiquitination / gamete generation / regulation of regulatory T cell differentiation / male meiotic nuclear division / double-strand break repair involved in meiotic recombination / homologous chromosome pairing at meiosis ...regulation of germ cell proliferation / regulation of CD40 signaling pathway / Fanconi anaemia nuclear complex / protein K29-linked ubiquitination / protein K27-linked ubiquitination / gamete generation / regulation of regulatory T cell differentiation / male meiotic nuclear division / double-strand break repair involved in meiotic recombination / homologous chromosome pairing at meiosis / neuronal stem cell population maintenance / protein K6-linked ubiquitination / replication-born double-strand break repair via sister chromatid exchange / brain morphogenesis / protein K11-linked ubiquitination / DNA repair complex / mitotic intra-S DNA damage checkpoint signaling / E2 ubiquitin-conjugating enzyme / female gonad development / ubiquitin conjugating enzyme activity / homeostasis of number of cells / protein K63-linked ubiquitination / spermatid development / protein monoubiquitination / negative regulation of double-strand break repair via homologous recombination / interstrand cross-link repair / protein K48-linked ubiquitination / positive regulation of double-strand break repair via homologous recombination / ovarian follicle development / protein autoubiquitination / condensed chromosome / DNA polymerase binding / Synthesis of active ubiquitin: roles of E1 and E2 enzymes / response to gamma radiation / mitochondrion organization / nucleotide-excision repair / TP53 Regulates Transcription of DNA Repair Genes / Fanconi Anemia Pathway / response to radiation / PKR-mediated signaling / RING-type E3 ubiquitin transferase / male gonad development / protein polyubiquitination / ubiquitin-protein transferase activity / ubiquitin protein ligase activity / nuclear envelope / regulation of cell population proliferation / chromosome / cellular response to oxidative stress / protein-containing complex assembly / regulation of inflammatory response / gene expression / damaged DNA binding / nuclear speck / nuclear body / DNA repair / intracellular membrane-bounded organelle / DNA damage response / ubiquitin protein ligase binding / chromatin binding / centrosome / chromatin / nucleolus / mitochondrion / DNA binding / zinc ion binding / nucleoplasm / ATP binding / nucleus / cytosol / cytoplasm Similarity search - Function | ||||||
| Biological species | Homo sapiens (human)synthetic construct (others) | ||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 4.2 Å | ||||||
Authors | Wang, S.L. / Pavletich, N.P. | ||||||
| Funding support | United States, 1items
| ||||||
Citation | Journal: Nat Struct Mol Biol / Year: 2021Title: Structure of the FA core ubiquitin ligase closing the ID clamp on DNA. Authors: Shengliu Wang / Renjing Wang / Christopher Peralta / Ayat Yaseen / Nikola P Pavletich / ![]() Abstract: The Fanconi anemia (FA) pathway is essential for the repair of DNA interstrand crosslinks. Central to the pathway is the FA core complex, a ubiquitin ligase of nine subunits that monoubiquitinates ...The Fanconi anemia (FA) pathway is essential for the repair of DNA interstrand crosslinks. Central to the pathway is the FA core complex, a ubiquitin ligase of nine subunits that monoubiquitinates the FANCI-FANCD2 (ID) DNA clamp. The 3.1 Å structure of the 1.1-MDa human FA core complex, described here, reveals an asymmetric assembly with two copies of all but the FANCC, FANCE and FANCF subunits. The asymmetry is crucial, as it prevents the binding of a second FANCC-FANCE-FANCF subcomplex that inhibits the recruitment of the UBE2T ubiquitin conjugating enzyme, and instead creates an ID binding site. A single active site then ubiquitinates FANCD2 and FANCI sequentially. We also present the 4.2-Å structures of the human core-UBE2T-ID-DNA complex in three conformations captured during monoubiquitination. They reveal the core-UBE2T complex remodeling the ID-DNA complex, closing the clamp on the DNA before ubiquitination. Monoubiquitination then prevents clamp opening after release from the core. | ||||||
| History |
|
-
Structure visualization
| Movie |
Movie viewer |
|---|---|
| Structure viewer | Molecule: Molmil Jmol/JSmol |
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7kzt.cif.gz | 8.5 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7kzt.ent.gz | Display | PDB format | |
| PDBx/mmJSON format | 7kzt.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Summary document | 7kzt_validation.pdf.gz | 1001.4 KB | Display | wwPDB validaton report |
|---|---|---|---|---|
| Full document | 7kzt_full_validation.pdf.gz | 1.2 MB | Display | |
| Data in XML | 7kzt_validation.xml.gz | 275.8 KB | Display | |
| Data in CIF | 7kzt_validation.cif.gz | 428.7 KB | Display | |
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/kz/7kzt ftp://data.pdbj.org/pub/pdb/validation_reports/kz/7kzt | HTTPS FTP |
-Related structure data
| Related structure data | ![]() 23089MC ![]() 7kzpC ![]() 7kzqC ![]() 7kzrC ![]() 7kzsC ![]() 7kzvC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-Fanconi anemia group ... , 7 types, 10 molecules ASBOCEFGHV
| #1: Protein | Mass: 165513.016 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCA, FAA, FACA, FANCH / Production host: Homo sapiens (human) / References: UniProt: O15360#2: Protein | Mass: 100640.172 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCB / Production host: Homo sapiens (human) / References: UniProt: Q8NB91#3: Protein | | Mass: 66290.359 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCC, FAC, FACC / Production host: Homo sapiens (human) / References: UniProt: Q00597#4: Protein | | Mass: 61026.086 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCE, FACE / Production host: Homo sapiens (human) / References: UniProt: Q9HB96#5: Protein | | Mass: 45108.297 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCF / Production host: Homo sapiens (human) / References: UniProt: Q9NPI8#6: Protein | Mass: 70873.727 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCG, XRCC9 / Production host: Homo sapiens (human) / References: UniProt: O15287#12: Protein | | Mass: 164325.516 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCD2, FACD / Production host: ![]() |
|---|
-Protein , 3 types, 4 molecules LMXU
| #7: Protein | Mass: 45203.953 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCL, PHF9 / Production host: Homo sapiens (human)References: UniProt: Q9NW38, RING-type E3 ubiquitin transferase #10: Protein | | Mass: 22553.873 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: UBE2T, HSPC150, PIG50 / Production host: ![]() References: UniProt: Q9NPD8, E2 ubiquitin-conjugating enzyme #11: Protein | | Mass: 149512.078 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FANCI / Production host: ![]() |
|---|
-Fanconi anemia core complex-associated protein ... , 2 types, 3 molecules PQW
| #8: Protein | Mass: 96513.898 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: FAAP100, C17orf70 / Production host: Homo sapiens (human) / References: UniProt: Q0VG06#9: Protein/peptide | | Mass: 4041.667 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Homo sapiens (human) |
|---|
-DNA chain , 2 types, 2 molecules YZ
| #13: DNA chain | Mass: 18036.518 Da / Num. of mol.: 1 / Source method: obtained synthetically / Source: (synth.) synthetic construct (others) |
|---|---|
| #14: DNA chain | Mass: 17716.326 Da / Num. of mol.: 1 / Source method: obtained synthetically / Source: (synth.) synthetic construct (others) |
-Non-polymers , 1 types, 5 molecules 
| #15: Chemical | ChemComp-ZN / |
|---|
-Details
| Has ligand of interest | N |
|---|---|
| Has protein modification | Y |
| Sequence details | The complete sequence of FAAP20 is MEAARRPRLGLSRRRPPPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSL ...The complete sequence of FAAP20 is MEAARRPRLG |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Human Fanconi Anaemia Core-UBE2T-ID-DNA complex / Type: COMPLEX / Entity ID: #1-#14 / Source: RECOMBINANT | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular weight | Value: 1.4 MDa / Experimental value: NO | |||||||||||||||||||||||||
| Source (natural) | Organism: Homo sapiens (human) | |||||||||||||||||||||||||
| Source (recombinant) | Organism: Homo sapiens (human) | |||||||||||||||||||||||||
| Buffer solution | pH: 8 | |||||||||||||||||||||||||
| Buffer component |
| |||||||||||||||||||||||||
| Specimen | Conc.: 1 mg/ml / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES | |||||||||||||||||||||||||
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD |
| Image recording | Electron dose: 36.5 e/Å2 / Detector mode: SUPER-RESOLUTION / Film or detector model: GATAN K3 (6k x 4k) |
-
Processing
| Software | Name: REFMAC / Version: 5.8.0267 / Classification: refinement | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 3D reconstruction | Resolution: 4.2 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 69111 / Symmetry type: POINT | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement | Resolution: 4.2→20 Å / Cor.coef. Fo:Fc: 0.86 / SU B: 96.751 / SU ML: 0.504 / ESU R: 0.845 Stereochemistry target values: MAXIMUM LIKELIHOOD WITH PHASES Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.9 Å / Shrinkage radii: 0.9 Å / VDW probe radii: 1.1 Å / Solvent model: MASK | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 115.132 Å2
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: 1 / Total: 87514 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi



Homo sapiens (human)
United States, 1items
Citation
UCSF Chimera














PDBj
















































