+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9i9l | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Structure of Far-Red Photosystem I from C. thermalis PCC 7203 | |||||||||||||||||||||||||||
Components |
| |||||||||||||||||||||||||||
Keywords | PHOTOSYNTHESIS / Chlorophyll f / Photosystem I / Far-red / cyanobacteria | |||||||||||||||||||||||||||
| Function / homology | Function and homology informationthylakoid membrane / photosystem I reaction center / photosystem I / photosynthetic electron transport in photosystem I / photosystem I / chlorophyll binding / plasma membrane-derived thylakoid membrane / photosynthesis / endomembrane system / 4 iron, 4 sulfur cluster binding ...thylakoid membrane / photosystem I reaction center / photosystem I / photosynthetic electron transport in photosystem I / photosystem I / chlorophyll binding / plasma membrane-derived thylakoid membrane / photosynthesis / endomembrane system / 4 iron, 4 sulfur cluster binding / oxidoreductase activity / electron transfer activity / magnesium ion binding / metal ion binding Similarity search - Function | |||||||||||||||||||||||||||
| Biological species | Chroococcidiopsis thermalis PCC 7203 (bacteria) | |||||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 1.89 Å | |||||||||||||||||||||||||||
Authors | Consoli, G. / Tufaill, F. / Murray, J.W. / Fantuzzi, A. / Rutherford, A.W. | |||||||||||||||||||||||||||
| Funding support | United Kingdom, 4items
| |||||||||||||||||||||||||||
Citation | Journal: Science / Year: 2025Title: Locating the missing chlorophylls f in far-red photosystem I. Authors: Giovanni Consoli / Fiazall Tufail / Ho Fong Leong / Stefania Viola / Geoffry A Davis / Nicholas Rew / Daniel Medranda / Michael Hofer / Paul Simpson / Marco Sandrin / Benoit Chachuat / Jenny ...Authors: Giovanni Consoli / Fiazall Tufail / Ho Fong Leong / Stefania Viola / Geoffry A Davis / Nicholas Rew / Daniel Medranda / Michael Hofer / Paul Simpson / Marco Sandrin / Benoit Chachuat / Jenny Nelson / Thomas Renger / James W Murray / Andrea Fantuzzi / A William Rutherford / ![]() Abstract: The discovery of chlorophyll f-containing photosystems, with their long-wavelength photochemistry, represented a distinct, low-energy paradigm for oxygenic photosynthesis. Structural studies on ...The discovery of chlorophyll f-containing photosystems, with their long-wavelength photochemistry, represented a distinct, low-energy paradigm for oxygenic photosynthesis. Structural studies on chlorophyll f-containing photosystem I could identify some chlorophyll f sites, but none among the photochemically active pigments, and thus concluded that chlorophyll f plays no photochemical role. Here, we report two cryo-electron microscopy structures of far-red photosystem I from PCC 7203, allowing the assignment of eight chlorophyll f molecules, including the redox active A. Simulations of absorption difference spectra induced by charge separation indicated that the experimental spectra can be reproduced only by considering the presence of a chlorophyll f at the A site. The chlorophyll f locations, wavelength assignments, and conserved far-red-specific residues provide functional insights for efficient use of long-wavelength photons. #1: Journal: Acta Crystallogr., Sect. D: Biol. Crystallogr. / Year: 2019Title: Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix Authors: Murray, J.W. / Afonine, P.V. / Baker, M.L. / Bunkoczi, G. / Chen, V.B. / Croll, T.I. / Hintze, B. / Hung, L.W. / Jain, S. / McCoy, A.J. / Moriarty, N.W. / Oeffner, R.D. / Poon, B.K. / ...Authors: Murray, J.W. / Afonine, P.V. / Baker, M.L. / Bunkoczi, G. / Chen, V.B. / Croll, T.I. / Hintze, B. / Hung, L.W. / Jain, S. / McCoy, A.J. / Moriarty, N.W. / Oeffner, R.D. / Poon, B.K. / Prisant, M.G. / Read, R.J. / Richardson, J.S. / Richardson, D.C. / Sammito, M.D. / Sobolev, O.V. / Stockwell, D.H. / Terwilliger, T.C. / Urzhumtsev, A.G. / Videau, L.L. / Williams, C.J. / Adams, P.D. | |||||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9i9l.cif.gz | 2.3 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9i9l.ent.gz | 1.6 MB | Display | PDB format |
| PDBx/mmJSON format | 9i9l.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/i9/9i9l ftp://data.pdbj.org/pub/pdb/validation_reports/i9/9i9l | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 52762MC ![]() 9eysC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-Photosystem I P700 chlorophyll a apoprotein ... , 2 types, 6 molecules ANaBOb
| #1: Protein | Mass: 86382.375 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: psaA, Chro_1019 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TWJ0, photosystem I #2: Protein | Mass: 83304.703 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: psaB, Chro_1018 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TVF3, photosystem I |
|---|
-Photosystem I reaction center subunit ... , 8 types, 24 molecules DQdEReFSfITgJUhKViLWjMYk
| #4: Protein | Mass: 15798.022 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_4755 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9U6S7 #5: Protein | Mass: 7634.748 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: psaE, Chro_2108 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TYF8 #6: Protein | Mass: 17859.723 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_2236 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TZX8 #7: Protein | Mass: 5879.917 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_1016 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TVX2 #8: Protein/peptide | Mass: 5297.427 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: Photosystem I reaction center subunit IX Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_2235 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TYS7 #9: Protein | Mass: 8201.732 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: MTVPNTISWSPQVALIISASSLLILLIASRSIKYPQVGAKLPVNLPVLGSPSVGTFVASMAFGHVVGAGIVLGLSNLGWL Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_1412 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TX25 #10: Protein | Mass: 19726.336 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_1017 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TX29 #11: Protein/peptide | Mass: 3540.284 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: psaM, Chro_0108 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TSY6 |
|---|
-Protein / Protein/peptide / Sugars , 3 types, 15 molecules CPcXZl

| #12: Protein/peptide | Mass: 3199.871 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: Chro_0654 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TUG4 #20: Sugar | ChemComp-LMT / #3: Protein | Mass: 8839.232 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Chroococcidiopsis thermalis PCC 7203 (bacteria)Gene: psaC, Chro_0777 Production host: Chroococcidiopsis thermalis PCC 7203 (bacteria)References: UniProt: K9TVB5, photosystem I |
|---|
-Non-polymers , 11 types, 798 molecules 


















| #13: Chemical | | #14: Chemical | ChemComp-F6C / #15: Chemical | ChemComp-CLA / #16: Chemical | ChemComp-PQN / #17: Chemical | ChemComp-SF4 / #18: Chemical | ChemComp-BCR / #19: Chemical | ChemComp-LHG / #21: Chemical | ChemComp-LMG / #22: Chemical | ChemComp-LFA / #23: Chemical | #24: Water | ChemComp-HOH / | |
|---|
-Details
| Has ligand of interest | Y |
|---|---|
| Has protein modification | Y |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Far Red Photosystem I / Type: COMPLEX Details: Trimeric photosystem I from C. thermalis grown under far-red light condition. Entity ID: #1-#12 / Source: NATURAL |
|---|---|
| Molecular weight | Experimental value: NO |
| Source (natural) | Organism: Chroococcidiopsis thermalis PCC 7203 (bacteria) / Cellular location: thylakoyd membrane |
| Buffer solution | pH: 7 |
| Specimen | Conc.: 1 mg/ml / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES / Details: monodispersed, good concentration |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: TFS KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: SPOT SCAN |
| Electron lens | Mode: DIFFRACTION / Nominal defocus max: 2000 nm / Nominal defocus min: 600 nm / Cs: 2.7 mm |
| Image recording | Electron dose: 40 e/Å2 / Film or detector model: FEI FALCON IV (4k x 4k) |
| Image scans | Width: 4096 / Height: 4096 |
-
Processing
| EM software | Name: PHENIX / Version: 1.21.2_5419 / Category: model refinement | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 1.89 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 300000 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refinement | Cross valid method: NONE Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2 | ||||||||||||||||||||||||
| Displacement parameters | Biso mean: 62.03 Å2 | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi




Chroococcidiopsis thermalis PCC 7203 (bacteria)
United Kingdom, 4items
Citation



PDBj











FIELD EMISSION GUN