[English] 日本語
Yorodumi- PDB-9cfq: Human DJ-1, no mixing, pink beam time-resolved serial crystallogr... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9cfq | ||||||
|---|---|---|---|---|---|---|---|
| Title | Human DJ-1, no mixing, pink beam time-resolved serial crystallography, CrystFEL processed | ||||||
Components | Parkinson disease protein 7 | ||||||
Keywords | HYDROLASE / Glutathione-independent glyoxalase / mix-and-inject serial crystallography / Laue diffraction | ||||||
| Function / homology | Function and homology informationpositive regulation of acute inflammatory response to antigenic stimulus / tyrosine 3-monooxygenase activator activity / cellular response to glyoxal / L-dopa decarboxylase activator activity / detoxification of hydrogen peroxide / : / : / guanine deglycation, glyoxal removal / cellular detoxification of methylglyoxal / regulation of supramolecular fiber organization ...positive regulation of acute inflammatory response to antigenic stimulus / tyrosine 3-monooxygenase activator activity / cellular response to glyoxal / L-dopa decarboxylase activator activity / detoxification of hydrogen peroxide / : / : / guanine deglycation, glyoxal removal / cellular detoxification of methylglyoxal / regulation of supramolecular fiber organization / negative regulation of death-inducing signaling complex assembly / negative regulation of TRAIL-activated apoptotic signaling pathway / positive regulation of L-dopa biosynthetic process / glyoxalase (glycolic acid-forming) activity / negative regulation of protein K48-linked deubiquitination / detection of oxidative stress / negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway / glycolate biosynthetic process / glyoxal metabolic process / guanine deglycation / detoxification of mercury ion / ubiquitin-protein transferase inhibitor activity / protein deglycase / hydrogen peroxide metabolic process / mercury ion binding / methylglyoxal metabolic process / protein deglycase activity / positive regulation of autophagy of mitochondrion / superoxide dismutase copper chaperone activity / oxidoreductase activity, acting on peroxide as acceptor / positive regulation of dopamine biosynthetic process / positive regulation of mitochondrial electron transport, NADH to ubiquinone / lactate biosynthetic process / negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway / protein repair / peptidase inhibitor activity / peroxiredoxin activity / Hydrolases; Acting on ester bonds; Thioester hydrolases / cellular detoxification of aldehyde / small protein activating enzyme binding / regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway / detoxification of copper ion / negative regulation of protein sumoylation / positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway / negative regulation of protein export from nucleus / cupric ion binding / negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway / regulation of androgen receptor signaling pathway / membrane hyperpolarization / Hydrolases; Acting on carbon-nitrogen bonds, other than peptide bonds; In linear amides / oxygen sensor activity / insulin secretion / androgen receptor signaling pathway / nuclear androgen receptor binding / negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide / ubiquitin-like protein conjugating enzyme binding / ubiquitin-specific protease binding / cytokine binding / dopamine uptake involved in synaptic transmission / positive regulation of reactive oxygen species biosynthetic process / cuprous ion binding / signaling receptor activator activity / membrane depolarization / regulation of synaptic vesicle endocytosis / single fertilization / negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway / negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway / negative regulation of reactive oxygen species biosynthetic process / negative regulation of proteasomal ubiquitin-dependent protein catabolic process / removal of superoxide radicals / negative regulation of protein ubiquitination / SUMOylation of transcription cofactors / regulation of neuron apoptotic process / negative regulation of extrinsic apoptotic signaling pathway / positive regulation of interleukin-8 production / regulation of mitochondrial membrane potential / adult locomotory behavior / adherens junction / centriole / mitochondrion organization / positive regulation of protein-containing complex assembly / Late endosomal microautophagy / PML body / mitochondrial intermembrane space / positive regulation of protein localization to nucleus / autophagy / enzyme activator activity / positive regulation of reactive oxygen species metabolic process / kinase binding / Chaperone Mediated Autophagy / cellular response to hydrogen peroxide / Aggrephagy / synaptic vesicle / peptidase activity / glucose homeostasis / cell body / regulation of inflammatory response / response to oxidative stress / cellular response to oxidative stress / sperm midpiece Similarity search - Function | ||||||
| Biological species | Homo sapiens (human) | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / FOURIER SYNTHESIS / Resolution: 1.9 Å | ||||||
Authors | Zielinski, K. / Dolamore, C. / Dalton, K. / Meisburger, S. / Smith, N. / Termini, J. / Henning, R. / Srajer, V. / Hekstra, D. / Pollack, L. / Wilson, M.A. | ||||||
| Funding support | United States, 1items
| ||||||
Citation | Journal: Biorxiv / Year: 2024Title: Resolving DJ-1 Glyoxalase Catalysis Using Mix-and-Inject Serial Crystallography at a Synchrotron. Authors: Zielinski, K.A. / Dolamore, C. / Dalton, K.M. / Smith, N. / Termini, J. / Henning, R. / Srajer, V. / Hekstra, D.R. / Pollack, L. / Wilson, M.A. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9cfq.cif.gz | 103.1 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9cfq.ent.gz | 64.8 KB | Display | PDB format |
| PDBx/mmJSON format | 9cfq.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/cf/9cfq ftp://data.pdbj.org/pub/pdb/validation_reports/cf/9cfq | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 9ceiC ![]() 9cfiC ![]() 9cfmC ![]() 9cfoC ![]() 9cfyC ![]() 9cfzC ![]() 9cg0C ![]() 9cgaC ![]() 9cgbC ![]() 9cgdC ![]() 9cgeC ![]() 9cgfC ![]() 9cggC ![]() 9cmxC ![]() 9cmyC C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||||||
| Unit cell |
|
-
Components
| #1: Protein | Mass: 20215.328 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: GSHMASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPY DVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAI(CSO)AGPTALLAHEIGFGSKVTTHPLAKDKMMNGG HYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD Source: (gene. exp.) Homo sapiens (human) / Gene: PARK7 / Plasmid: pET-15b / Production host: ![]() References: UniProt: Q99497, Hydrolases; Acting on ester bonds; Thioester hydrolases, Hydrolases; Acting on carbon-nitrogen bonds, other than peptide bonds; In linear amides, protein deglycase |
|---|---|
| #2: Water | ChemComp-HOH / |
| Has ligand of interest | N |
| Has protein modification | Y |
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 3.21 Å3/Da / Density % sol: 61.66 % |
|---|---|
| Crystal grow | Temperature: 293 K / Method: batch mode / pH: 7.5 / Details: 100 mM HEPES, 200 mM NaCl, 15% (w/v) PEG 3350 |
-Data collection
| Diffraction | Mean temperature: 293 K / Serial crystal experiment: Y | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: APS / Beamline: 14-ID-B / Wavelength: 1.240-1.016 | |||||||||
| Detector | Type: RAYONIX MX340-HS / Detector: CCD / Date: Nov 10, 2022 | |||||||||
| Radiation | Protocol: LAUE / Monochromatic (M) / Laue (L): L / Scattering type: x-ray | |||||||||
| Radiation wavelength |
| |||||||||
| Reflection | Resolution: 1.77→32.96 Å / Num. obs: 25005 / % possible obs: 99.03 % / Redundancy: 246 % / Biso Wilson estimate: 26.88 Å2 / CC1/2: 0.99 / R split: 0.0598 / Net I/σ(I): 7.74 | |||||||||
| Reflection shell | Resolution: 1.77→1.8 Å / Mean I/σ(I) obs: 0.43 / Num. unique obs: 2426 / CC1/2: 0.05 / % possible all: 98.62 | |||||||||
| Serial crystallography sample delivery | Description: Concentric flow injector / Method: injection | |||||||||
| Serial crystallography sample delivery injection | Description: flow focused diffusive mixer / Flow rate: 1 µL/min | |||||||||
| Serial crystallography data reduction | Crystal hits: 5332 / Frames indexed: 5073 / Frames total: 89887 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: FOURIER SYNTHESIS / Resolution: 1.9→32.96 Å / SU ML: 0.1848 / Cross valid method: FREE R-VALUE / σ(F): 1.35 / Phase error: 18.2506 Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 32.75 Å2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 1.9→32.96 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell |
|
Movie
Controller
About Yorodumi



Homo sapiens (human)
X-RAY DIFFRACTION
United States, 1items
Citation














PDBj





