[English] 日本語

- PDB-9cfq: Human DJ-1, no mixing, pink beam time-resolved serial crystallogr... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 9cfq | ||||||
---|---|---|---|---|---|---|---|
Title | Human DJ-1, no mixing, pink beam time-resolved serial crystallography, CrystFEL processed | ||||||
![]() | Parkinson disease protein 7 | ||||||
![]() | HYDROLASE / Glutathione-independent glyoxalase / mix-and-inject serial crystallography / Laue diffraction | ||||||
Function / homology | ![]() tyrosine 3-monooxygenase activator activity / cellular response to glyoxal / L-dopa decarboxylase activator activity / detoxification of hydrogen peroxide / methylglyoxal catabolic process to lactate / guanine deglycation, methylglyoxal removal / guanine deglycation, glyoxal removal / cellular detoxification of methylglyoxal / regulation of supramolecular fiber organization / negative regulation of death-inducing signaling complex assembly ...tyrosine 3-monooxygenase activator activity / cellular response to glyoxal / L-dopa decarboxylase activator activity / detoxification of hydrogen peroxide / methylglyoxal catabolic process to lactate / guanine deglycation, methylglyoxal removal / guanine deglycation, glyoxal removal / cellular detoxification of methylglyoxal / regulation of supramolecular fiber organization / negative regulation of death-inducing signaling complex assembly / negative regulation of TRAIL-activated apoptotic signaling pathway / positive regulation of L-dopa biosynthetic process / glyoxalase (glycolic acid-forming) activity / negative regulation of protein K48-linked deubiquitination / negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway / glycolate biosynthetic process / detection of oxidative stress / glyoxal metabolic process / guanine deglycation / methylglyoxal metabolic process / detoxification of mercury ion / ubiquitin-protein transferase inhibitor activity / protein deglycase / mercury ion binding / protein deglycase activity / positive regulation of dopamine biosynthetic process / oxidoreductase activity, acting on peroxide as acceptor / positive regulation of autophagy of mitochondrion / superoxide dismutase copper chaperone activity / positive regulation of mitochondrial electron transport, NADH to ubiquinone / negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway / lactate biosynthetic process / positive regulation of acute inflammatory response to antigenic stimulus / protein repair / peptidase inhibitor activity / cellular detoxification of aldehyde / peroxiredoxin activity / Hydrolases; Acting on ester bonds; Thioester hydrolases / small protein activating enzyme binding / regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway / detoxification of copper ion / positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway / negative regulation of protein sumoylation / negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway / negative regulation of protein export from nucleus / cupric ion binding / regulation of androgen receptor signaling pathway / membrane hyperpolarization / Hydrolases; Acting on carbon-nitrogen bonds, other than peptide bonds; In linear amides / oxygen sensor activity / negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide / insulin secretion / ubiquitin-like protein conjugating enzyme binding / nuclear androgen receptor binding / hydrogen peroxide metabolic process / dopamine uptake involved in synaptic transmission / ubiquitin-specific protease binding / cytokine binding / positive regulation of reactive oxygen species biosynthetic process / cuprous ion binding / androgen receptor signaling pathway / regulation of neuron apoptotic process / signaling receptor activator activity / membrane depolarization / regulation of synaptic vesicle endocytosis / single fertilization / negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway / negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway / negative regulation of reactive oxygen species biosynthetic process / negative regulation of proteasomal ubiquitin-dependent protein catabolic process / negative regulation of protein ubiquitination / regulation of mitochondrial membrane potential / removal of superoxide radicals / SUMOylation of transcription cofactors / adult locomotory behavior / Late endosomal microautophagy / negative regulation of extrinsic apoptotic signaling pathway / positive regulation of interleukin-8 production / mitochondrion organization / adherens junction / positive regulation of protein-containing complex assembly / enzyme activator activity / PML body / Chaperone Mediated Autophagy / mitochondrial intermembrane space / autophagy / Aggrephagy / positive regulation of protein localization to nucleus / kinase binding / cellular response to hydrogen peroxide / positive regulation of reactive oxygen species metabolic process / synaptic vesicle / glucose homeostasis / peptidase activity / cell body / cellular response to oxidative stress / regulation of inflammatory response / scaffold protein binding / DNA-binding transcription factor binding / response to oxidative stress Similarity search - Function | ||||||
Biological species | ![]() | ||||||
Method | ![]() ![]() ![]() | ||||||
![]() | Zielinski, K. / Dolamore, C. / Dalton, K. / Meisburger, S. / Smith, N. / Termini, J. / Henning, R. / Srajer, V. / Hekstra, D. / Pollack, L. / Wilson, M.A. | ||||||
Funding support | ![]()
| ||||||
![]() | ![]() Title: Resolving DJ-1 Glyoxalase Catalysis Using Mix-and-Inject Serial Crystallography at a Synchrotron. Authors: Zielinski, K.A. / Dolamore, C. / Dalton, K.M. / Smith, N. / Termini, J. / Henning, R. / Srajer, V. / Hekstra, D.R. / Pollack, L. / Wilson, M.A. | ||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 103.1 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 64.8 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 412.1 KB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 412.2 KB | Display | |
Data in XML | ![]() | 11.8 KB | Display | |
Data in CIF | ![]() | 15.6 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 9ceiC ![]() 9cfiC ![]() 9cfmC ![]() 9cfoC ![]() 9cfyC ![]() 9cfzC ![]() 9cg0C ![]() 9cgaC ![]() 9cgbC ![]() 9cgdC ![]() 9cgeC ![]() 9cgfC ![]() 9cggC ![]() 9cmxC ![]() 9cmyC C: citing same article ( |
---|---|
Similar structure data | Similarity search - Function & homology ![]() |
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 | ![]()
| ||||||||||||
Unit cell |
|
-
Components
#1: Protein | Mass: 20215.328 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: GSHMASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPY DVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAI(CSO)AGPTALLAHEIGFGSKVTTHPLAKDKMMNGG HYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD Source: (gene. exp.) ![]() ![]() ![]() References: UniProt: Q99497, Hydrolases; Acting on ester bonds; Thioester hydrolases, Hydrolases; Acting on carbon-nitrogen bonds, other than peptide bonds; In linear amides, protein deglycase |
---|---|
#2: Water | ChemComp-HOH / |
Has ligand of interest | N |
Has protein modification | Y |
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 3.21 Å3/Da / Density % sol: 61.66 % |
---|---|
Crystal grow | Temperature: 293 K / Method: batch mode / pH: 7.5 / Details: 100 mM HEPES, 200 mM NaCl, 15% (w/v) PEG 3350 |
-Data collection
Diffraction | Mean temperature: 293 K / Serial crystal experiment: Y | |||||||||
---|---|---|---|---|---|---|---|---|---|---|
Diffraction source | Source: ![]() ![]() ![]() | |||||||||
Detector | Type: RAYONIX MX340-HS / Detector: CCD / Date: Nov 10, 2022 | |||||||||
Radiation | Protocol: LAUE / Monochromatic (M) / Laue (L): L / Scattering type: x-ray | |||||||||
Radiation wavelength |
| |||||||||
Reflection | Resolution: 1.77→32.96 Å / Num. obs: 25005 / % possible obs: 99.03 % / Redundancy: 246 % / Biso Wilson estimate: 26.88 Å2 / CC1/2: 0.99 / R split: 0.0598 / Net I/σ(I): 7.74 | |||||||||
Reflection shell | Resolution: 1.77→1.8 Å / Mean I/σ(I) obs: 0.43 / Num. unique obs: 2426 / CC1/2: 0.05 / % possible all: 98.62 | |||||||||
Serial crystallography sample delivery | Description: Concentric flow injector / Method: injection | |||||||||
Serial crystallography sample delivery injection | Description: flow focused diffusive mixer / Flow rate: 1 µL/min | |||||||||
Serial crystallography data reduction | Crystal hits: 5332 / Frames indexed: 5073 / Frames total: 89887 |
-
Processing
Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]() Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Displacement parameters | Biso mean: 32.75 Å2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement step | Cycle: LAST / Resolution: 1.9→32.96 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
LS refinement shell |
|