[English] 日本語
Yorodumi- PDB-8s6k: Crystal structure of ScFv-G2D11 complexed to a bis-Tn glycopeptide -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 8s6k | ||||||
|---|---|---|---|---|---|---|---|
| Title | Crystal structure of ScFv-G2D11 complexed to a bis-Tn glycopeptide | ||||||
Components |
| ||||||
Keywords | IMMUNE SYSTEM / Monoclonal antibody / ScFv-G2D11 | ||||||
| Function / homology | Function and homology informationDefective GALNT3 causes HFTC / Defective C1GALT1C1 causes TNPS / Defective GALNT12 causes CRCS1 / Termination of O-glycan biosynthesis / O-linked glycosylation of mucins / negative regulation of cell adhesion mediated by integrin / negative regulation of transcription by competitive promoter binding / negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator / Dectin-2 family / mitotic G1 DNA damage checkpoint signaling ...Defective GALNT3 causes HFTC / Defective C1GALT1C1 causes TNPS / Defective GALNT12 causes CRCS1 / Termination of O-glycan biosynthesis / O-linked glycosylation of mucins / negative regulation of cell adhesion mediated by integrin / negative regulation of transcription by competitive promoter binding / negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator / Dectin-2 family / mitotic G1 DNA damage checkpoint signaling / transcription coregulator activity / DNA damage response, signal transduction by p53 class mediator / Golgi lumen / p53 binding / Interleukin-4 and Interleukin-13 signaling / vesicle / apical plasma membrane / RNA polymerase II cis-regulatory region sequence-specific DNA binding / chromatin / positive regulation of transcription by RNA polymerase II / extracellular space / extracellular exosome / nucleus / plasma membrane Similarity search - Function | ||||||
| Biological species | ![]() Homo sapiens (human) | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.75 Å | ||||||
Authors | Hurtado-Guerrero, R. / Macias-Leon, J. | ||||||
| Funding support | Spain, 1items
| ||||||
Citation | Journal: Nat.Chem.Biol. / Year: 2025Title: Recognizing Tn and STn Epitopes in Protein Context: Structural Advances in Phage Display Libraries for Tumor-Specific Antibody Discovery Authors: Hurtado-Guerrero, R. / Gatos, S. / Gines-Alcober, I. / Macias-Leon, J. / Manuel Gonzalez-Ramirez, A. / Kasapoglu, I. / Veloz, B. / Companon, I. / Ghirardello, M. / Merino, P. / Corzana, F. / Blixt, O. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 8s6k.cif.gz | 207.3 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb8s6k.ent.gz | 164.7 KB | Display | PDB format |
| PDBx/mmJSON format | 8s6k.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Summary document | 8s6k_validation.pdf.gz | 1.5 MB | Display | wwPDB validaton report |
|---|---|---|---|---|
| Full document | 8s6k_full_validation.pdf.gz | 1.5 MB | Display | |
| Data in XML | 8s6k_validation.xml.gz | 31.1 KB | Display | |
| Data in CIF | 8s6k_validation.cif.gz | 43.1 KB | Display | |
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/s6/8s6k ftp://data.pdbj.org/pub/pdb/validation_reports/s6/8s6k | HTTPS FTP |
-Related structure data
| Related structure data | ![]() 8s6tC ![]() 8s6vC ![]() 8s73C C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| 2 | ![]()
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Unit cell |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Noncrystallographic symmetry (NCS) | NCS domain:
NCS domain segments: Component-ID: _ / Refine code: _
NCS ensembles :
|
-
Components
| #1: Antibody | Mass: 26933.785 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Details: SSGGGGSGGGGGSSGSSDVVMTQSHKFMSTSVGDRVSITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYSSYPLTFGGGTKLEMKRGGHHHHHH Source: (gene. exp.) ![]() Komagataella pastoris (fungus)#2: Protein/peptide | Mass: 597.642 Da / Num. of mol.: 2 / Source method: obtained synthetically / Source: (synth.) Homo sapiens (human) / References: UniProt: P15941#3: Chemical | ChemComp-EDO / #4: Sugar | ChemComp-A2G / #5: Water | ChemComp-HOH / | Has ligand of interest | Y | Has protein modification | Y | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.44 Å3/Da / Density % sol: 49.58 % |
|---|---|
| Crystal grow | Temperature: 291 K / Method: vapor diffusion, sitting drop / pH: 8 / Details: lithium chloride Tris PEG 8000 |
-Data collection
| Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: Diamond / Beamline: I24 / Wavelength: 0.9999 Å |
| Detector | Type: DECTRIS PILATUS3 S 6M / Detector: PIXEL / Date: Dec 9, 2020 |
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 0.9999 Å / Relative weight: 1 |
| Reflection | Resolution: 1.75→20 Å / Num. obs: 52287 / % possible obs: 96.5 % / Redundancy: 3.5 % / CC1/2: 0.996 / Rmerge(I) obs: 0.085 / Net I/σ(I): 7.3 |
| Reflection shell | Resolution: 1.75→1.84 Å / Rmerge(I) obs: 0.489 / Mean I/σ(I) obs: 1.7 / Num. unique obs: 6651 / CC1/2: 0.778 / % possible all: 84.6 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENT / Resolution: 1.75→19.9 Å / Cor.coef. Fo:Fc: 0.959 / Cor.coef. Fo:Fc free: 0.94 / SU B: 5.487 / SU ML: 0.089 / Cross valid method: THROUGHOUT / ESU R: 0.117 / ESU R Free: 0.116 / Stereochemistry target values: MAXIMUM LIKELIHOOD / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 23.741 Å2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: 1 / Resolution: 1.75→19.9 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi




Homo sapiens (human)
X-RAY DIFFRACTION
Spain, 1items
Citation


PDBj







Komagataella pastoris (fungus)


