[English] 日本語

- PDB-8qx2: Aplysia californica acetylcholine-binding protein in complex with... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 8qx2 | ||||||
---|---|---|---|---|---|---|---|
Title | Aplysia californica acetylcholine-binding protein in complex with racemic spiroimine (+)/(-)-4 | ||||||
![]() | Soluble acetylcholine receptor | ||||||
![]() | CHOLINE-BINDING PROTEIN / ACHBP / complex / spiroimine / Aplysia californica | ||||||
Function / homology | ![]() extracellular ligand-gated monoatomic ion channel activity / transmembrane signaling receptor activity / metal ion binding / identical protein binding / membrane Similarity search - Function | ||||||
Biological species | ![]() ![]() | ||||||
Method | ![]() ![]() ![]() | ||||||
![]() | Sulzenbacher, G. / Bourne, Y. / Marchot, P. | ||||||
Funding support | ![]()
| ||||||
![]() | ![]() Title: The Cyclic Imine Core Common to the Marine Macrocyclic Toxins Is Sufficient to Dictate Nicotinic Acetylcholine Receptor Antagonism. Authors: Bourne, Y. / Sulzenbacher, G. / Chabaud, L. / Araoz, R. / Radic, Z. / Conrod, S. / Taylor, P. / Guillou, C. / Molgo, J. / Marchot, P. | ||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 438.9 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 361.8 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 2.4 MB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 2.4 MB | Display | |
Data in XML | ![]() | 43.7 KB | Display | |
Data in CIF | ![]() | 61.4 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 8q1mC ![]() 8qtlC C: citing same article ( |
---|---|
Similar structure data | Similarity search - Function & homology ![]() |
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||
---|---|---|---|---|---|---|---|---|---|
1 |
| ||||||||
Unit cell |
|
-
Components
#1: Protein | Mass: 24727.484 Da / Num. of mol.: 5 / Fragment: UNP residues 18-225 Source method: isolated from a genetically manipulated source Details: ...Details: DYKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR Source: (gene. exp.) ![]() ![]() Cell line (production host): HEK293S GnTI / Production host: ![]() #2: Chemical | ChemComp-ILR / Mass: 223.311 Da / Num. of mol.: 5 / Source method: obtained synthetically / Formula: C13H21NO2 / Feature type: SUBJECT OF INVESTIGATION #3: Chemical | ChemComp-IPA / | #4: Water | ChemComp-HOH / | Has ligand of interest | Y | Has protein modification | Y | |
---|
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 2.49 Å3/Da / Density % sol: 51 % |
---|---|
Crystal grow | Temperature: 293 K / Method: vapor diffusion, hanging drop / pH: 7.4 Details: 10% polyethylene glycol 1500 (w/v), 0.1 M sodium citrate buffer pH 5.5, 24% isopropanol (v/v) |
-Data collection
Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
---|---|
Diffraction source | Source: ![]() ![]() ![]() |
Detector | Type: ADSC QUANTUM 315r / Detector: CCD / Date: Jul 23, 2009 |
Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
Radiation wavelength | Wavelength: 0.9708 Å / Relative weight: 1 |
Reflection | Resolution: 2.1→65.61 Å / Num. obs: 72272 / % possible obs: 99.7 % / Redundancy: 3.5 % / CC1/2: 0.993 / Rmerge(I) obs: 0.109 / Rpim(I) all: 0.065 / Rrim(I) all: 0.128 / Χ2: 0.85 / Net I/σ(I): 8.7 / Num. measured all: 253219 |
Reflection shell | Resolution: 2.1→2.15 Å / % possible obs: 100 % / Redundancy: 3.6 % / Rmerge(I) obs: 0.614 / Num. measured all: 15594 / Num. unique obs: 4374 / CC1/2: 0.687 / Rpim(I) all: 0.369 / Rrim(I) all: 0.72 / Χ2: 0.73 / Net I/σ(I) obs: 2.1 |
-
Processing
Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]()
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: BABINET MODEL WITH MASK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Displacement parameters | Biso mean: 36.68 Å2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement step | Cycle: 1 / Resolution: 2.1→64.7 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refine LS restraints |
|