[English] 日本語
Yorodumi
- PDB-8otz: 48-nm repeat of the native axonemal doublet microtubule from bovi... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 8otz
Title48-nm repeat of the native axonemal doublet microtubule from bovine sperm
Components
  • (Cilia- and flagella-associated protein ...) x 11
  • (EF-hand domain-containing ...) x 4
  • (Outer dense fiber of sperm tails ...) x 3
  • (Piercer of microtubule wall ...) x 2
  • (Stabilizer of axonemal microtubules ...) x 2
  • (Testis expressed ...) x 2
  • (Testis-expressed ...) x 2
  • (Uncharacterized protein ...) x 4
  • ATP6V1F neighbor
  • CFAP97 domain containing 1
  • Chromosome 13 C20orf85 homolog
  • Chromosome 19 C17orf98 homolog
  • Chromosome 20 C5orf49 homolog
  • Chromosome 7 open reading frame 31
  • Cilia and flagella associated protein 77
  • Cilia- and flagella- associated protein 210
  • Coiled-coil domain-containing protein 105
  • Dual specificity phosphatase 21
  • EF-hand calcium-binding domain-containing protein 3
  • Enkurin
  • Family with sequence similarity 166 member A
  • Meiosis-specific nuclear structural protein 1
  • Nucleoside diphosphate kinase 7
  • Parkin coregulated gene protein
  • Protein FAM166C
  • Protein Flattop
  • Protein phosphatase 1 regulatory subunit 32
  • RIB43A-like with coiled-coils protein 2
  • Sperm acrosome associated 9
  • Sperm-associated antigen 8
  • Spermatid-specific manchette-related protein 1
  • Spermatogenesis-associated protein 48
  • TEPP protein
  • Tektin bundle interacting protein 1
  • Tektin-1
  • Tektin-2
  • Tektin-3
  • Tektin-4
  • Tektin-5
  • Testis specific serine kinase 6
  • Theg spermatid protein like
  • Tubulin alpha-3 chain
  • Tubulin beta-4B chain
  • UPF0602 protein C4orf47 homolog
KeywordsSTRUCTURAL PROTEIN / microtubule / cilia / sperm / axoneme
Function / homology
Function and homology information


axonemal microtubule doublet inner sheath / outer acrosomal membrane / epithelial cilium movement involved in determination of left/right asymmetry / regulation of brood size / establishment of left/right asymmetry / 9+0 motile cilium / sperm flagellum assembly / manchette assembly / axonemal B tubule inner sheath / axonemal A tubule inner sheath ...axonemal microtubule doublet inner sheath / outer acrosomal membrane / epithelial cilium movement involved in determination of left/right asymmetry / regulation of brood size / establishment of left/right asymmetry / 9+0 motile cilium / sperm flagellum assembly / manchette assembly / axonemal B tubule inner sheath / axonemal A tubule inner sheath / protein polyglutamylation / sperm axoneme assembly / inner dynein arm assembly / regulation of calcineurin-NFAT signaling cascade / Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane / Cilium Assembly / Intraflagellar transport / Carboxyterminal post-translational modifications of tubulin / Sealing of the nuclear envelope (NE) by ESCRT-III / Kinesins / positive regulation of feeding behavior / Resolution of Sister Chromatid Cohesion / Mitotic Prometaphase / EML4 and NUDC in mitotic spindle formation / cilium-dependent cell motility / COPI-dependent Golgi-to-ER retrograde traffic / COPI-independent Golgi-to-ER retrograde traffic / COPI-mediated anterograde transport / Transferases; Transferring phosphorus-containing groups / sperm principal piece / RHO GTPases activate IQGAPs / cerebrospinal fluid circulation / MAP kinase tyrosine/serine/threonine phosphatase activity / regulation of cilium beat frequency involved in ciliary motility / RHO GTPases Activate Formins / cilium movement involved in cell motility / regulation of store-operated calcium entry / MHC class II antigen presentation / HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand / acrosomal membrane / axoneme assembly / cilium movement / ciliary transition zone / Aggrephagy / calcium ion sensor activity / axonemal microtubule / sperm DNA condensation / The role of GTSE1 in G2/M progression after G2 checkpoint / Separation of Sister Chromatids / cilium organization / Loss of Nlp from mitotic centrosomes / Recruitment of mitotic centrosome proteins and complexes / Loss of proteins required for interphase microtubule organization from the centrosome / Anchoring of the basal body to the plasma membrane / AURKA Activation by TPX2 / Recruitment of NuMA to mitotic centrosomes / gamma-tubulin ring complex / manchette / Regulation of PLK1 Activity at G2/M Transition / Hedgehog 'off' state / flagellated sperm motility / UTP biosynthetic process / CTP biosynthetic process / determination of left/right symmetry / Neutrophil degranulation / positive regulation of cell motility / motile cilium / nucleoside diphosphate kinase activity / GTP biosynthetic process / AMP binding / ciliary base / regulation of neuron projection development / protein serine/threonine phosphatase activity / cerebral cortex cell migration / microtubule organizing center / mitotic cytokinesis / regulation of cell division / cellular response to UV-C / axoneme / cilium assembly / glial cell projection / spermatid development / alpha-tubulin binding / beta-tubulin binding / single fertilization / sperm flagellum / phosphatase binding / intercellular bridge / cytoplasmic microtubule / sperm midpiece / Hsp70 protein binding / 3'-5' exonuclease activity / centriole / acrosomal vesicle / protein tyrosine phosphatase activity / mitotic spindle organization / meiotic cell cycle / Hsp90 protein binding / G protein-coupled receptor binding / structural constituent of cytoskeleton
Similarity search - Function
Protein of unknown function DUF4542 / Uncharacterized protein C1orf100 / Sperm microtubule associated protein 1 / Family of unknown function (DUF5530) / Testicular haploid expressed repeat / Uncharacterised protein family C20orf85 / Protein of unknown function DUF4562 / Spermatid-specific manchette-related protein 1 / Testis-expressed protein 33 / Testis-expressed sequence 37 protein ...Protein of unknown function DUF4542 / Uncharacterized protein C1orf100 / Sperm microtubule associated protein 1 / Family of unknown function (DUF5530) / Testicular haploid expressed repeat / Uncharacterised protein family C20orf85 / Protein of unknown function DUF4562 / Spermatid-specific manchette-related protein 1 / Testis-expressed protein 33 / Testis-expressed sequence 37 protein / CFAP97 domain-containing protein 1/2 / Testicular haploid expressed gene protein-like / Testis-specific serine/threonine-protein kinase 6, catalytic domain / C10orf82-like / : / : / Testicular haploid expressed repeat / Normal lung function maintenance, Low in Lung Cancer 1 protein / Domain of unknown function (DUF4562) / Spermatid-specific manchette-related protein 1 / TSC21 family / Testis-expressed sequence 33 protein family / Sperm-associated microtubule inner protein 5 / Ciliary microtubule inner protein 3 / Repeats in THEG (testicular haploid expressed gene) and several fly proteins. / Protein phosphatase 1 regulatory subunit 32 / Testis, prostate and placenta-expressed protein / Testis-expressed protein 49 / Protein phosphatase 1 regulatory subunit 32 / Sperm microtubule inner protein 8 / Sperm microtubule inner protein 11 / : / : / Sperm microtubule inner protein 1 / Protein of unknown function DUF1143 / Atypical dual specificity phosphatase, subfamily B / Protein of unknown function DUF4513 / Hemingway/CFA97 / Cilia- and flagella-associated protein 68 / Hemingway/CFA97 / Sperm-associated microtubule inner protein 10 / Protein of unknown function DUF4541 / Tektin bundle interacting protein 1 / Coiled-coil domain-containing protein 105 / Tektin bundle interacting protein 1 / Cilia and flagella associated protein 90 / DJBP, EF-hand domain / Protein of unknown function DUF4586 / : / EF-hand domain / Cilia-and flagella-associated protein 96 / Sperm-tail PG-rich repeat / FAM183 family / Sperm-tail PG-rich repeat / FAM183A and FAM183B related / Sperm-associated antigen 8 / Cilia- and flagella-associated protein 95 / NDPK7, first NDPk domain / Cilia- and flagella-associated protein 107 / : / Protein CFAP95 / Cilia- and flagella-associated protein 143 / Cilia and flagella associated protein 107 / Tektin / Cilia- and flagella-associated protein 276 / Sperm acrosome-associated protein 9 / : / Tektin family / Protein of unknown function (DUF3695) / Sperm acrosome-associated protein 9 / Uncharacterised protein FAM166/UPF0605 / Cilia- and flagella-associated protein 77 / Ciliary microtubule inner protein 2B-like / Cilia- and flagella-associated protein 77 / Nucleoside diphosphate kinase 7 / Piercer of microtubule wall 1/2 / Piercer of microtubule wall 1/2 / Cilia- and flagella-associated protein 141 / Cilia- and flagella-associated protein 141 / Cilia- and flagella-associated protein 161-like domain / : / EFHB C-terminal EF-hand domain / : / Nucleoside diphosphate kinase 7 N-terminal PH domain / Meiosis-specific nuclear structural protein 1 / Cilia- and flagella-associated protein 45 / NDPK7, second NDPk domain / Cilia- and flagella- associated protein 210 / CFAP53/TCHP / Trichohyalin-plectin-homology domain / Trichohyalin-plectin-homology domain / RIB43A / RIB43A / DM10 domain / EF-hand domain-containing protein EFHC1/EFHC2/EFHB / DM10 domain / DM10 domain profile. / Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases. / Enkurin domain / :
Similarity search - Domain/homology
GUANOSINE-5'-DIPHOSPHATE / GUANOSINE-5'-TRIPHOSPHATE / Ciliary microtubule inner protein 3 / Piercer of microtubule wall 2 protein / Cilia and flagella associated protein 77 / Cilia and flagella associated protein 90 / Sperm microtubule associated protein 2 like / Sperm microtubule inner protein 11 / Sperm acrosome associated 9 / EF-hand domain-containing family member C2 ...GUANOSINE-5'-DIPHOSPHATE / GUANOSINE-5'-TRIPHOSPHATE / Ciliary microtubule inner protein 3 / Piercer of microtubule wall 2 protein / Cilia and flagella associated protein 77 / Cilia and flagella associated protein 90 / Sperm microtubule associated protein 2 like / Sperm microtubule inner protein 11 / Sperm acrosome associated 9 / EF-hand domain-containing family member C2 / Ciliary microtubule inner protein 1 / Protein SPMIP9 / Parkin coregulated gene protein / Tektin-3 / Sperm-associated microtubule inner protein 5 / Cilia- and flagella-associated protein 144 / Sperm-associated microtubule inner protein 10 / Sperm microtubule inner protein 8 / Enkurin / Cilia- and flagella-associated protein 276 / Sperm microtubule associated protein 1 / Cilia- and flagella- associated protein 210 / Cilia- and flagella-associated protein 52 / EF-hand domain-containing protein 1 / Sperm-associated antigen 8 / EF-hand domain-containing family member B / Tektin bundle interacting protein 1 / Testis-specific serine/threonine-protein kinase 6 / Cilia- and flagella-associated protein 53 / Cilia- and flagella-associated protein 161 / CFAP97 domain containing 1 / Outer dense fiber of sperm tails 3 / Ciliary microtubule inner protein 2A / Sperm microtubule inner protein 1 / EF-hand calcium binding domain 6 / Dual specificity phosphatase 21 / Meiosis-specific nuclear structural protein 1 / Protein SPMIP2 / Cilia-and flagella-associated protein 96 / EF-hand calcium-binding domain-containing protein 3 / Cilia- and flagella-associated protein 68 / Tektin-2 / Stabilizer of axonemal microtubules 4 / Cilia- and flagella-associated protein 107 / Tektin-4 / Tektin-5 / Tektin-like protein 1 / Tubulin alpha-3 chain / Sperm microtubule inner protein 6 / Tektin-1 / Protein SPMIP3 / Cilia- and flagella-associated protein 141 / Cilia- and flagella-associated protein 95 / Ciliary microtubule inner protein 4 / RIB43A-like with coiled-coils protein 2 / Cilia- and flagella-associated protein 45 / Piercer of microtubule wall 1 protein / Tubulin beta-4B chain / Ciliary microtubule inner protein 2C / Nucleoside diphosphate kinase homolog 7 / Cilia- and flagella-associated protein 20
Similarity search - Component
Biological speciesBos taurus (domestic cattle)
MethodELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.6 Å
AuthorsLeung, M.R. / Zeng, J. / Zhang, R. / Zeev-Ben-Mordehai, T.
Funding support Netherlands, 1items
OrganizationGrant numberCountry
Netherlands Organisation for Scientific Research (NWO)740.018.007 Netherlands
CitationJournal: Cell / Year: 2023
Title: Structural specializations of the sperm tail.
Authors: Miguel Ricardo Leung / Jianwei Zeng / Xiangli Wang / Marc C Roelofs / Wei Huang / Riccardo Zenezini Chiozzi / Johannes F Hevler / Albert J R Heck / Susan K Dutcher / Alan Brown / Rui Zhang / ...Authors: Miguel Ricardo Leung / Jianwei Zeng / Xiangli Wang / Marc C Roelofs / Wei Huang / Riccardo Zenezini Chiozzi / Johannes F Hevler / Albert J R Heck / Susan K Dutcher / Alan Brown / Rui Zhang / Tzviya Zeev-Ben-Mordehai /
Abstract: Sperm motility is crucial to reproductive success in sexually reproducing organisms. Impaired sperm movement causes male infertility, which is increasing globally. Sperm are powered by a microtubule- ...Sperm motility is crucial to reproductive success in sexually reproducing organisms. Impaired sperm movement causes male infertility, which is increasing globally. Sperm are powered by a microtubule-based molecular machine-the axoneme-but it is unclear how axonemal microtubules are ornamented to support motility in diverse fertilization environments. Here, we present high-resolution structures of native axonemal doublet microtubules (DMTs) from sea urchin and bovine sperm, representing external and internal fertilizers. We identify >60 proteins decorating sperm DMTs; at least 15 are sperm associated and 16 are linked to infertility. By comparing DMTs across species and cell types, we define core microtubule inner proteins (MIPs) and analyze evolution of the tektin bundle. We identify conserved axonemal microtubule-associated proteins (MAPs) with unique tubulin-binding modes. Additionally, we identify a testis-specific serine/threonine kinase that links DMTs to outer dense fibers in mammalian sperm. Our study provides structural foundations for understanding sperm evolution, motility, and dysfunction at a molecular level.
History
DepositionApr 21, 2023Deposition site: PDBE / Processing site: PDBE
Revision 1.0Nov 22, 2023Provider: repository / Type: Initial release

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
0: Cilia- and flagella-associated protein 95
0A: Sperm acrosome associated 9
0C: Sperm acrosome associated 9
0E: Sperm acrosome associated 9
0G: Sperm acrosome associated 9
0W: Sperm acrosome associated 9
0Y: Sperm acrosome associated 9
0a: Sperm acrosome associated 9
0c: Sperm acrosome associated 9
0e: Sperm acrosome associated 9
0g: Sperm acrosome associated 9
0i: Sperm acrosome associated 9
0k: Sperm acrosome associated 9
1: Testis specific serine kinase 6
2: Testis specific serine kinase 6
3: EF-hand domain-containing protein
A: ATP6V1F neighbor
A0: Outer dense fiber of sperm tails 3 like 1
A1: Outer dense fiber of sperm tails 3
A2: Outer dense fiber of sperm tails 3
A3: Outer dense fiber of sperm tails 3
A4: Outer dense fiber of sperm tails 3
A5: Outer dense fiber of sperm tails 3
A6: Outer dense fiber of sperm tails 3
A7: Outer dense fiber of sperm tails 3
A8: Outer dense fiber of sperm tails 3
A9: Outer dense fiber of sperm tails 3
AA: Tubulin alpha-3 chain
AB: Tubulin beta-4B chain
AC: Tubulin alpha-3 chain
AD: Tubulin beta-4B chain
AE: Tubulin alpha-3 chain
AF: Tubulin beta-4B chain
AG: Tubulin alpha-3 chain
AH: Tubulin beta-4B chain
AI: Tubulin alpha-3 chain
AJ: Tubulin beta-4B chain
AK: Tubulin alpha-3 chain
AL: Tubulin beta-4B chain
AM: Tubulin alpha-3 chain
AP: Protein Flattop
AQ: Protein Flattop
AR: Protein Flattop
AS: Protein Flattop
AT: Cilia- and flagella-associated protein 53
AU: Cilia- and flagella-associated protein 53
AV: Nucleoside diphosphate kinase 7
AW: Nucleoside diphosphate kinase 7
Aa: EF-hand domain-containing family member C2
Ab: EF-hand domain-containing family member C2
Ac: EF-hand domain-containing family member C2
Ad: EF-hand domain-containing family member C2
Al: Family with sequence similarity 166 member A
Am: Family with sequence similarity 166 member A
An: Family with sequence similarity 166 member A
Ao: Family with sequence similarity 166 member A
Ap: Protein FAM166C
Aq: Protein FAM166C
Ar: Protein FAM166C
At: Outer dense fiber of sperm tails 3B
Au: Outer dense fiber of sperm tails 3
Av: Outer dense fiber of sperm tails 3
Aw: Outer dense fiber of sperm tails 3
Ax: Outer dense fiber of sperm tails 3B
Ay: Outer dense fiber of sperm tails 3
Az: Outer dense fiber of sperm tails 3
B: ATP6V1F neighbor
B0: Spermatid-specific manchette-related protein 1
B1: Spermatid-specific manchette-related protein 1
B2: Spermatid-specific manchette-related protein 1
B3: Spermatid-specific manchette-related protein 1
B4: Spermatid-specific manchette-related protein 1
B5: Enkurin
B6: Enkurin
B7: Family with sequence similarity 166 member A
B8: Spermatid-specific manchette-related protein 1
B9: Spermatid-specific manchette-related protein 1
BA: Tubulin alpha-3 chain
BB: Tubulin beta-4B chain
BC: Tubulin alpha-3 chain
BD: Tubulin beta-4B chain
BE: Tubulin alpha-3 chain
BF: Tubulin beta-4B chain
BG: Tubulin alpha-3 chain
BH: Tubulin beta-4B chain
BI: Tubulin alpha-3 chain
BJ: Tubulin beta-4B chain
BK: Tubulin alpha-3 chain
BL: Tubulin beta-4B chain
BM: Tubulin alpha-3 chain
BN: Outer dense fiber of sperm tails 3 like 1
BO: Coiled-coil domain-containing protein 105
BP: Coiled-coil domain-containing protein 105
BQ: Coiled-coil domain-containing protein 105
BR: Coiled-coil domain-containing protein 105
BS: Protein phosphatase 1 regulatory subunit 32
BT: Protein phosphatase 1 regulatory subunit 32
BU: RIB43A-like with coiled-coils protein 2
BV: RIB43A-like with coiled-coils protein 2
BW: Cilia- and flagella-associated protein 107
BX: Cilia- and flagella-associated protein 107
BY: Family with sequence similarity 166 member A
BZ: Family with sequence similarity 166 member A
Ba: Family with sequence similarity 166 member A
Bb: Family with sequence similarity 166 member A
Bc: Family with sequence similarity 166 member A
Bd: Family with sequence similarity 166 member A
Be: Family with sequence similarity 166 member A
Bf: Piercer of microtubule wall 1 protein
Bg: Piercer of microtubule wall 1 protein
Bh: Piercer of microtubule wall 2 protein
Bi: RIB43A-like with coiled-coils protein 2
Bj: RIB43A-like with coiled-coils protein 2
Bk: RIB43A-like with coiled-coils protein 2
Bl: Stabilizer of axonemal microtubules 1
Bm: Stabilizer of axonemal microtubules 1
Bn: Stabilizer of axonemal microtubules 1
Bo: Stabilizer of axonemal microtubules 1
Bp: Stabilizer of axonemal microtubules 1
Bq: Stabilizer of axonemal microtubules 3
Br: Meiosis-specific nuclear structural protein 1
Bs: Meiosis-specific nuclear structural protein 1
Bu: Stabilizer of axonemal microtubules 3
By: Enkurin
Bz: Enkurin
C: ATP6V1F neighbor
C0: Tektin-3
C1: Tektin-5
C2: Tektin-3
C3: Tektin-3
C4: Tektin-3
C5: Tektin-3
C6: Tektin-3
C7: Tektin-3
C8: Tektin-3
C9: Tektin-3
CA: Tubulin alpha-3 chain
CB: Tubulin beta-4B chain
CC: Tubulin alpha-3 chain
CD: Tubulin beta-4B chain
CE: Tubulin alpha-3 chain
CF: Tubulin beta-4B chain
CG: Tubulin alpha-3 chain
CH: Tubulin beta-4B chain
CI: Tubulin alpha-3 chain
CJ: Tubulin beta-4B chain
CK: Tubulin alpha-3 chain
CL: Tubulin beta-4B chain
CM: Tubulin alpha-3 chain
CN: Family with sequence similarity 166 member A
CO: Family with sequence similarity 166 member A
CQ: Spermatid-specific manchette-related protein 1
CR: Spermatid-specific manchette-related protein 1
CS: Spermatid-specific manchette-related protein 1
CT: Sperm acrosome associated 9
CU: Sperm acrosome associated 9
CV: Sperm acrosome associated 9
CW: Sperm-associated antigen 8
CX: Sperm acrosome associated 9
CY: Sperm acrosome associated 9
CZ: Sperm acrosome associated 9
Ca: Sperm acrosome associated 9
Cb: Sperm acrosome associated 9
Cc: Sperm acrosome associated 9
Cd: Sperm acrosome associated 9
Ce: Sperm acrosome associated 9
Cf: Sperm acrosome associated 9
Cg: Sperm acrosome associated 9
Ch: Sperm acrosome associated 9
Ci: Sperm acrosome associated 9
Cj: Sperm acrosome associated 9
Ck: Sperm acrosome associated 9
Cl: Spermatogenesis-associated protein 48
Cm: Tektin-1
Cn: Tektin-1
Co: Tektin-1
Cp: Tektin-1
Cq: Tektin-2
Cr: Tektin-2
Cs: Tektin-2
Ct: Tektin-2
Cu: Tektin-2
Cv: Tektin-2
Cw: Tektin-2
Cx: Tektin-2
Cy: Tektin-2
Cz: Tektin-5
D: Uncharacterized protein C1orf100 homolog
D0: Tektin-5
D1: Tektin-5
D2: Tektin-5
D3: Tektin-5
D4: Tektin-5
D5: Tektin-5
D6: Tektin-5
D7: Tektin-5
D8: Tektin-5
D9: Tektin-5
DA: Tubulin alpha-3 chain
DB: Tubulin beta-4B chain
DC: Tubulin alpha-3 chain
DD: Tubulin beta-4B chain
DE: Tubulin alpha-3 chain
DF: Tubulin beta-4B chain
DG: Tubulin alpha-3 chain
DH: Tubulin beta-4B chain
DI: Tubulin alpha-3 chain
DJ: Tubulin beta-4B chain
DK: Tubulin alpha-3 chain
DL: Tubulin beta-4B chain
DM: Tubulin alpha-3 chain
DN: Tubulin beta-4B chain
DO: Tektin-3
DP: Tektin-5
DQ: Tektin-5
DR: Tektin-5
DS: Tektin-5
DT: Tektin-5
DU: Tektin-5
DV: Tektin-5
DW: Tektin-5
DX: Tektin-5
DY: TEPP protein
DZ: TEPP protein
Da: TEPP protein
Db: Uncharacterized protein MGC137036
Dc: Uncharacterized protein MGC137036
Dd: Uncharacterized protein MGC137036
De: Testis expressed 33
Df: Testis-expressed sequence 37 protein
Dg: Testis-expressed sequence 37 protein
Dh: Testis-expressed sequence 37 protein
Di: Testis-expressed protein 43
Dj: Testis-expressed protein 43
Dk: Testis-expressed protein 43
Dl: Testis-expressed protein 43
Dm: Testis expressed 49
Dn: Theg spermatid protein like
E: EF-hand domain-containing family member B
E1: Tektin bundle interacting protein 1
E2: Tektin bundle interacting protein 1
E3: Tektin bundle interacting protein 1
E4: Tektin bundle interacting protein 1
EA: Tektin-5
EB: Tubulin beta-4B chain
EC: Tubulin alpha-3 chain
ED: Tubulin beta-4B chain
EE: Tubulin alpha-3 chain
EF: Tubulin beta-4B chain
EG: Tubulin alpha-3 chain
EH: Tubulin beta-4B chain
EI: Tubulin alpha-3 chain
EJ: Tubulin beta-4B chain
EK: Tubulin alpha-3 chain
EL: Tubulin beta-4B chain
EM: Tubulin alpha-3 chain
EN: Tubulin beta-4B chain
EO: Tektin-5
EP: Tektin-5
EQ: Tektin-5
ER: Tektin-5
ES: Tektin-4
ET: Tektin-4
EU: Tektin-4
EV: Tektin-4
EW: Tektin-4
EX: Tektin-4
EY: Tektin-4
EZ: Tektin-4
Ee: TEPP protein
F: EF-hand domain-containing family member B
F2: Tektin-3
F3: Tektin-3
F4: Tektin-3
F5: Tektin-3
F6: Tektin-3
FB: Tubulin beta-4B chain
FC: Tubulin alpha-3 chain
FD: Tubulin beta-4B chain
FE: Tubulin alpha-3 chain
FF: Tubulin beta-4B chain
FG: Tubulin alpha-3 chain
FH: Tubulin beta-4B chain
FI: Tubulin alpha-3 chain
FJ: Tubulin beta-4B chain
FK: Tubulin alpha-3 chain
FL: Tubulin beta-4B chain
FM: Tubulin alpha-3 chain
FN: Tubulin beta-4B chain
G: Chromosome 7 open reading frame 31
GB: Tubulin beta-4B chain
GC: Tubulin alpha-3 chain
GD: Tubulin beta-4B chain
GE: Tubulin alpha-3 chain
GF: Tubulin beta-4B chain
GG: Tubulin alpha-3 chain
GH: Tubulin beta-4B chain
GI: Tubulin alpha-3 chain
GJ: Tubulin beta-4B chain
GK: Tubulin alpha-3 chain
GL: Tubulin beta-4B chain
GM: Tubulin alpha-3 chain
GN: Tubulin beta-4B chain
H: Cilia- and flagella- associated protein 210
HB: Tubulin beta-4B chain
HC: Tubulin alpha-3 chain
HD: Tubulin beta-4B chain
HE: Tubulin alpha-3 chain
HF: Tubulin beta-4B chain
HG: Tubulin alpha-3 chain
HH: Tubulin beta-4B chain
HI: Tubulin alpha-3 chain
HJ: Tubulin beta-4B chain
HK: Tubulin alpha-3 chain
HL: Tubulin beta-4B chain
HM: Tubulin alpha-3 chain
HN: Tubulin beta-4B chain
HO: Tubulin alpha-3 chain
I: EF-hand domain-containing protein 1
IB: Tubulin beta-4B chain
IC: Tubulin alpha-3 chain
ID: Tubulin beta-4B chain
IE: Tubulin alpha-3 chain
IF: Tubulin beta-4B chain
IG: Tubulin alpha-3 chain
IH: Tubulin beta-4B chain
II: Tubulin alpha-3 chain
IJ: Tubulin beta-4B chain
IK: Tubulin alpha-3 chain
IL: Tubulin beta-4B chain
IM: Tubulin alpha-3 chain
IN: Tubulin beta-4B chain
IO: Tubulin alpha-3 chain
J: Uncharacterized protein C10orf82 homolog
JB: Tubulin beta-4B chain
JC: Tubulin alpha-3 chain
JD: Tubulin beta-4B chain
JE: Tubulin alpha-3 chain
JF: Tubulin beta-4B chain
JG: Tubulin alpha-3 chain
JH: Tubulin beta-4B chain
JI: Tubulin alpha-3 chain
JJ: Tubulin beta-4B chain
JK: Tubulin alpha-3 chain
JL: Tubulin beta-4B chain
JM: Tubulin alpha-3 chain
JN: Tubulin beta-4B chain
K: Uncharacterized protein C10orf82 homolog
K1: Cilia- and flagella-associated protein 144
KB: Tubulin beta-4B chain
KC: Tubulin alpha-3 chain
KD: Tubulin beta-4B chain
KE: Tubulin alpha-3 chain
KF: Tubulin beta-4B chain
KG: Tubulin alpha-3 chain
KH: Tubulin beta-4B chain
KI: Tubulin alpha-3 chain
KJ: Tubulin beta-4B chain
KK: Tubulin alpha-3 chain
KL: Tubulin beta-4B chain
KM: Tubulin alpha-3 chain
KN: Tubulin beta-4B chain
KO: Tubulin alpha-3 chain
L: Uncharacterized protein C10orf82 homolog
L1: Chromosome 20 C5orf49 homolog
L2: Chromosome 20 C5orf49 homolog
LB: Tubulin beta-4B chain
LC: Tubulin alpha-3 chain
LD: Tubulin beta-4B chain
LE: Tubulin alpha-3 chain
LF: Tubulin beta-4B chain
LG: Tubulin alpha-3 chain
LH: Tubulin beta-4B chain
LI: Tubulin alpha-3 chain
LJ: Tubulin beta-4B chain
LK: Tubulin alpha-3 chain
LL: Tubulin beta-4B chain
LM: Tubulin alpha-3 chain
LN: Tubulin beta-4B chain
M: Uncharacterized protein C10orf82 homolog
MB: Tubulin beta-4B chain
MC: Tubulin alpha-3 chain
MD: Tubulin beta-4B chain
ME: Tubulin alpha-3 chain
MF: Tubulin beta-4B chain
MG: Tubulin alpha-3 chain
MH: Tubulin beta-4B chain
MI: Tubulin alpha-3 chain
MJ: Tubulin beta-4B chain
MK: Tubulin alpha-3 chain
ML: Tubulin beta-4B chain
MM: Tubulin alpha-3 chain
MN: Tubulin beta-4B chain
N: Chromosome 19 C17orf98 homolog
N0: Tubulin beta-4B chain
NA: Tubulin alpha-3 chain
NB: Tubulin beta-4B chain
NC: Tubulin alpha-3 chain
ND: Tubulin beta-4B chain
NE: Tubulin alpha-3 chain
NF: Tubulin beta-4B chain
NG: Tubulin alpha-3 chain
NH: Tubulin beta-4B chain
NI: Tubulin alpha-3 chain
NJ: Tubulin beta-4B chain
NK: Tubulin alpha-3 chain
NL: Tubulin beta-4B chain
O: Chromosome 19 C17orf98 homolog
O0: Tubulin beta-4B chain
OA: Tubulin alpha-3 chain
OB: Tubulin beta-4B chain
OC: Tubulin alpha-3 chain
OD: Tubulin beta-4B chain
OE: Tubulin alpha-3 chain
OF: Tubulin beta-4B chain
OG: Tubulin alpha-3 chain
OH: Tubulin beta-4B chain
OI: Tubulin alpha-3 chain
OJ: Tubulin beta-4B chain
OK: Tubulin alpha-3 chain
OL: Tubulin beta-4B chain
P: Chromosome 13 C20orf85 homolog
PA: Tubulin alpha-3 chain
PB: Tubulin beta-4B chain
PC: Tubulin alpha-3 chain
PD: Tubulin beta-4B chain
PE: Tubulin alpha-3 chain
PF: Tubulin beta-4B chain
PG: Tubulin alpha-3 chain
PH: Tubulin beta-4B chain
PI: Tubulin alpha-3 chain
PJ: Tubulin beta-4B chain
PK: Tubulin alpha-3 chain
PL: Tubulin beta-4B chain
PM: Tubulin alpha-3 chain
Q: Cilia- and flagella-associated protein 68
QA: Tubulin alpha-3 chain
QB: Tubulin beta-4B chain
QC: Tubulin alpha-3 chain
QD: Tubulin beta-4B chain
QE: Tubulin alpha-3 chain
QF: Tubulin beta-4B chain
QG: Tubulin alpha-3 chain
QH: Tubulin beta-4B chain
QI: Tubulin alpha-3 chain
QJ: Tubulin beta-4B chain
QK: Tubulin alpha-3 chain
QL: Tubulin beta-4B chain
QM: Tubulin alpha-3 chain
R: Cilia and flagella associated protein 77
RA: Tubulin alpha-3 chain
RB: Tubulin beta-4B chain
RC: Tubulin alpha-3 chain
RD: Tubulin beta-4B chain
RE: Tubulin alpha-3 chain
RF: Tubulin beta-4B chain
RG: Tubulin alpha-3 chain
RH: Tubulin beta-4B chain
RI: Tubulin alpha-3 chain
RJ: Tubulin beta-4B chain
RK: Tubulin alpha-3 chain
RL: Tubulin beta-4B chain
RM: Tubulin alpha-3 chain
S: Cilia and flagella associated protein 77
SA: Tubulin alpha-3 chain
SB: Tubulin beta-4B chain
SC: Tubulin alpha-3 chain
SD: Tubulin beta-4B chain
SE: Tubulin alpha-3 chain
SF: Tubulin beta-4B chain
SG: Tubulin alpha-3 chain
SH: Tubulin beta-4B chain
SI: Tubulin alpha-3 chain
SJ: Tubulin beta-4B chain
SK: Tubulin alpha-3 chain
SL: Tubulin beta-4B chain
SM: Tubulin alpha-3 chain
T: Cilia and flagella associated protein 77
TB: Tubulin beta-4B chain
TC: Tubulin alpha-3 chain
TD: Tubulin beta-4B chain
TE: Tubulin alpha-3 chain
TF: Tubulin beta-4B chain
TG: Tubulin alpha-3 chain
TH: Tubulin beta-4B chain
TI: Tubulin alpha-3 chain
TJ: Tubulin beta-4B chain
TK: Tubulin alpha-3 chain
TL: Tubulin beta-4B chain
TM: Tubulin alpha-3 chain
U: Cilia and flagella associated protein 77
UB: Tubulin beta-4B chain
UC: Tubulin alpha-3 chain
UD: Tubulin beta-4B chain
UE: Tubulin alpha-3 chain
UF: Tubulin beta-4B chain
UG: Tubulin alpha-3 chain
UH: Tubulin beta-4B chain
UI: Tubulin alpha-3 chain
UJ: Tubulin beta-4B chain
UK: Tubulin alpha-3 chain
UL: Tubulin beta-4B chain
UM: Tubulin alpha-3 chain
UN: Tubulin beta-4B chain
V: Cilia- and flagella-associated protein 95
VB: Tubulin beta-4B chain
VC: Tubulin alpha-3 chain
VD: Tubulin beta-4B chain
VE: Tubulin alpha-3 chain
VF: Tubulin beta-4B chain
VG: Tubulin alpha-3 chain
VH: Tubulin beta-4B chain
VI: Tubulin alpha-3 chain
VJ: Tubulin beta-4B chain
VK: Tubulin alpha-3 chain
VL: Tubulin beta-4B chain
VM: Tubulin alpha-3 chain
VN: Tubulin beta-4B chain
W: UPF0602 protein C4orf47 homolog
WB: Tubulin beta-4B chain
WC: Tubulin alpha-3 chain
WD: Tubulin beta-4B chain
WE: Tubulin alpha-3 chain
WF: Tubulin beta-4B chain
WG: Tubulin alpha-3 chain
WH: Tubulin beta-4B chain
WI: Tubulin alpha-3 chain
WJ: Tubulin beta-4B chain
WK: Tubulin alpha-3 chain
WL: Tubulin beta-4B chain
WM: Tubulin alpha-3 chain
WN: Tubulin beta-4B chain
X: EF-hand domain-containing protein 1
XG: Cilia- and flagella-associated protein 20
XH: Cilia- and flagella-associated protein 20
XI: Cilia- and flagella-associated protein 20
XJ: Cilia- and flagella-associated protein 20
XK: Cilia- and flagella-associated protein 20
XL: Cilia- and flagella-associated protein 20
XM: Cilia- and flagella-associated protein 20
Y: EF-hand domain-containing protein 1
YG: Parkin coregulated gene protein
YH: Parkin coregulated gene protein
YI: Parkin coregulated gene protein
YJ: Parkin coregulated gene protein
YK: Parkin coregulated gene protein
YL: Parkin coregulated gene protein
Z: CFAP97 domain containing 1
a: Cilia- and flagella-associated protein 45
b: Cilia- and flagella-associated protein 45
c: Cilia- and flagella-associated protein 45
d: Cilia- and flagella-associated protein 45
e: Cilia- and flagella-associated protein 52
f: Cilia- and flagella-associated protein 52
g: Cilia- and flagella-associated protein 52
h: Cilia- and flagella-associated protein 141
i: Cilia- and flagella-associated protein 161
j: Cilia- and flagella-associated protein 161
k: Dual specificity phosphatase 21
ke: Uncharacterized protein C4orf45 homolog
l: Dual specificity phosphatase 21
m: Dual specificity phosphatase 21
n: Dual specificity phosphatase 21
o: Cilia- and flagella- associated protein 210
p: CFAP97 domain containing 1
q: CFAP97 domain containing 1
r: Cilia- and flagella-associated protein 276
s: Cilia- and flagella-associated protein 276
t: Cilia- and flagella-associated protein 276
u: EF-hand calcium-binding domain-containing protein 3
v: EF-hand calcium-binding domain-containing protein 3
w: EF-hand calcium-binding domain-containing protein 3
x: Testis specific serine kinase 6
y: EF-hand domain-containing protein
z: EF-hand domain-containing protein
hetero molecules


Theoretical massNumber of molelcules
Total (without water)25,760,4041026
Polymers25,611,019575
Non-polymers149,385451
Water00
1


  • Idetical with deposited unit
  • defined by author
  • Evidence: electron microscopy
TypeNameSymmetry operationNumber
identity operation1_5551

-
Components

+
Cilia- and flagella-associated protein ... , 11 types, 28 molecules 0VATAUBWBXK1QXGXHXIXJXKXLXMabcdefghijrst

#1: Protein Cilia- and flagella-associated protein 95


Mass: 26661.025 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32L77
#11: Protein Cilia- and flagella-associated protein 53


Mass: 62138.992 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: F1N7G5
#22: Protein Cilia- and flagella-associated protein 107


Mass: 23271.453 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2TA11
#49: Protein Cilia- and flagella-associated protein 144 / Protein FAM183A


Mass: 16178.324 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A8QW39
#53: Protein Cilia- and flagella-associated protein 68


Mass: 20163.260 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2T9Q3
#56: Protein
Cilia- and flagella-associated protein 20


Mass: 22781.389 Da / Num. of mol.: 7 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q6B857
#59: Protein
Cilia- and flagella-associated protein 45


Mass: 65800.328 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32LN4
#60: Protein Cilia- and flagella-associated protein 52


Mass: 68719.602 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1BKF9
#61: Protein Cilia- and flagella-associated protein 141


Mass: 12361.437 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32L75
#62: Protein Cilia- and flagella-associated protein 161


Mass: 36519.594 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: F6RJC2
#65: Protein Cilia- and flagella-associated protein 276


Mass: 19387.805 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1B9I5

+
Protein , 36 types, 489 molecules 0A0C0E0G0W0Y0a0c0e0g0i0kCTCUCVCXCYCZCaCbCcCdCeCfCgChCiCjCk1...

#2: Protein ...
Sperm acrosome associated 9


Mass: 25174.801 Da / Num. of mol.: 29 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1MYU9
#3: Protein Testis specific serine kinase 6


Mass: 30256.893 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: F1N2S7
#5: Protein ATP6V1F neighbor


Mass: 20279.707 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: G3X8G1
#8: Protein ...
Tubulin alpha-3 chain / Alpha-tubulin 3


Mass: 49978.344 Da / Num. of mol.: 149 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)
References: UniProt: Q32KN8, Hydrolases; Acting on acid anhydrides; Acting on GTP to facilitate cellular and subcellular movement
#9: Protein ...
Tubulin beta-4B chain / Tubulin beta-2C chain


Mass: 49877.824 Da / Num. of mol.: 153 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q3MHM5
#10: Protein
Protein Flattop


Mass: 21214.035 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)
#12: Protein Nucleoside diphosphate kinase 7 / NDK 7 / NDP kinase 7


Mass: 42650.895 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q5E9Y9, nucleoside-diphosphate kinase
#14: Protein
Family with sequence similarity 166 member A


Mass: 36251.363 Da / Num. of mol.: 14 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: G3X6E2
#15: Protein Protein FAM166C


Mass: 23414.553 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q3SZR5
#17: Protein
Spermatid-specific manchette-related protein 1 / Ciliated bronchial epithelial protein 1


Mass: 35109.043 Da / Num. of mol.: 10 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32KP0
#18: Protein
Enkurin


Mass: 30215.129 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1B836
#19: Protein
Coiled-coil domain-containing protein 105


Mass: 57747.836 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2YDN4
#20: Protein Protein phosphatase 1 regulatory subunit 32


Mass: 47818.125 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2T9T0
#21: Protein
RIB43A-like with coiled-coils protein 2


Mass: 44773.418 Da / Num. of mol.: 5 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32LJ7
#27: Protein Meiosis-specific nuclear structural protein 1


Mass: 60538.367 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2KIQ2
#28: Protein
Tektin-3


Mass: 56760.910 Da / Num. of mol.: 15 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A6H782
#29: Protein ...
Tektin-5


Mass: 56564.809 Da / Num. of mol.: 26 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2YDI7
#30: Protein Sperm-associated antigen 8


Mass: 51604.398 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1BNS6
#31: Protein Spermatogenesis-associated protein 48


Mass: 49735.164 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)
#32: Protein
Tektin-1


Mass: 48798.375 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32KZ9
#33: Protein
Tektin-2


Mass: 49962.656 Da / Num. of mol.: 9 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2T9Q6
#35: Protein
TEPP protein / Testis / prostate and placenta expressed


Mass: 24939.441 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: C9QNT9
#41: Protein Theg spermatid protein like


Mass: 50941.473 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1MNS9
#43: Protein
Tektin bundle interacting protein 1


Mass: 24559.482 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: F1MZJ1
#44: Protein
Tektin-4


Mass: 52025.488 Da / Num. of mol.: 8 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2TA38
#45: Protein Chromosome 7 open reading frame 31


Mass: 67685.570 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)
#46: Protein Cilia- and flagella- associated protein 210


Mass: 65437.598 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1BJL9
#50: Protein Chromosome 20 C5orf49 homolog


Mass: 16820.848 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1LU45
#51: Protein Chromosome 19 C17orf98 homolog


Mass: 17813.178 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1BC62
#52: Protein Chromosome 13 C20orf85 homolog


Mass: 15810.196 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3S5ZPE5
#54: Protein
Cilia and flagella associated protein 77


Mass: 32999.203 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1LJD6
#55: Protein UPF0602 protein C4orf47 homolog


Mass: 34554.371 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2T9M0
#57: Protein
Parkin coregulated gene protein


Mass: 29323.059 Da / Num. of mol.: 6 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A5PK71
#58: Protein CFAP97 domain containing 1


Mass: 19600.385 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: G3N1Q7
#63: Protein
Dual specificity phosphatase 21 / Similar to Dual specificity protein phosphatase 18 (Low molecular weight dual specificity phosphatase 20)


Mass: 22075.557 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q0II40
#66: Protein EF-hand calcium-binding domain-containing protein 3


Mass: 50207.961 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2T9P0

+
EF-hand domain-containing ... , 4 types, 12 molecules 3yzAaAbAcAdEFIXY

#4: Protein EF-hand domain-containing protein


Mass: 31349.949 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: G5E5A3
#13: Protein
EF-hand domain-containing family member C2


Mass: 85566.766 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1N1R0
#42: Protein EF-hand domain-containing family member B / Cilia- and flagella-associated protein 21


Mass: 97960.547 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: F1MMV1
#47: Protein EF-hand domain-containing protein 1 / Myoclonin-1


Mass: 74125.344 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: E1BKH1

+
Outer dense fiber of sperm tails ... , 3 types, 18 molecules A0BNA1A2A3A4A5A6A7A8A9AuAvAwAyAzAtAx

#6: Protein Outer dense fiber of sperm tails 3 like 1


Mass: 30860.854 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)
#7: Protein
Outer dense fiber of sperm tails 3


Mass: 27684.936 Da / Num. of mol.: 14 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: G3X6A7
#16: Protein Outer dense fiber of sperm tails 3B


Mass: 32579.918 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)

+
Piercer of microtubule wall ... , 2 types, 3 molecules BfBgBh

#23: Protein Piercer of microtubule wall 1 protein / Pierce1 / UPF0691 protein C9orf116 homolog


Mass: 15673.458 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32P67
#24: Protein Piercer of microtubule wall 2 protein


Mass: 13784.531 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1LFK7

+
Stabilizer of axonemal microtubules ... , 2 types, 7 molecules BlBmBnBoBpBqBu

#25: Protein
Stabilizer of axonemal microtubules 1


Mass: 40613.059 Da / Num. of mol.: 5 / Source method: isolated from a natural source
Details: MAPTKGKCVCELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPVYHSYLPRESFKPKM DYQRACTPMEGLTTSRRDFGPHKVLPVKIHQPNPFVPSEENMDLQTTYKQDYNPYPLCRV DPFKPRDSKYPCGDKMESLPTYKADYLPWNQPRRELLRPPHHYRPASTKFDSRTTQQDDY ...Details: MAPTKGKCVCELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPVYHSYLPRESFKPKM DYQRACTPMEGLTTSRRDFGPHKVLPVKIHQPNPFVPSEENMDLQTTYKQDYNPYPLCRV DPFKPRDSKYPCGDKMESLPTYKADYLPWNQPRRELLRPPHHYRPASTKFDSRTTQQDDY SMKGLVNTRSCKPPAVPKLCNVPLEDLTNYKMSYVAHPLEKRFVHESEKFRPCEIPFESL TTHKESYRGLMGEPAKSLKPPARPYGLDTPFSNTTEFRDKYQAWPTPQVFSKPPSMYVPP EEKMDLLTTVQTHYTYPKGAPAESCRPALSVKKGGRFEGSTTTKEDYKQWASTRTEPAKP IPQLNLPTEPLDCLTTARAHYVPHLPMMTKSCKPVWSGPQGNIPVEGQTTYTISFTPKEM SRCLASYPEPPGYIFEEIDALGHRIYRPVSQTGSRRSSRFSVGDSENPNQQELTVSA
Source: (natural) Bos taurus (domestic cattle)
#26: Protein Stabilizer of axonemal microtubules 3


Mass: 37465.422 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle)

+
Uncharacterized protein ... , 4 types, 9 molecules DDbDcDdJKLMke

#34: Protein Uncharacterized protein C1orf100 homolog


Mass: 16642.066 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32L72
#36: Protein Uncharacterized protein MGC137036


Mass: 21238.109 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1LFG5
#48: Protein
Uncharacterized protein C10orf82 homolog


Mass: 26677.043 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A6QPC0
#64: Protein Uncharacterized protein C4orf45 homolog


Mass: 22640.896 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q2KIR0

+
Testis expressed ... , 2 types, 2 molecules DeDm

#37: Protein Testis expressed 33 / Uncharacterized protein MGC133880


Mass: 30322.604 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: Q32LI7
#40: Protein Testis expressed 49


Mass: 15441.421 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A0A3Q1MT14

+
Testis-expressed ... , 2 types, 7 molecules DfDgDhDiDjDkDl

#38: Protein Testis-expressed sequence 37 protein


Mass: 20375.061 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A5PJD8
#39: Protein
Testis-expressed protein 43


Mass: 15209.745 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Bos taurus (domestic cattle) / References: UniProt: A8SMG2

+
Non-polymers , 3 types, 451 molecules

#67: Chemical...
ChemComp-GTP / GUANOSINE-5'-TRIPHOSPHATE


Mass: 523.180 Da / Num. of mol.: 149 / Source method: obtained synthetically / Formula: C10H16N5O14P3 / Comment: GTP, energy-carrying molecule*YM
#68: Chemical...
ChemComp-MG / MAGNESIUM ION


Mass: 24.305 Da / Num. of mol.: 149 / Source method: obtained synthetically / Formula: Mg
#69: Chemical...
ChemComp-GDP / GUANOSINE-5'-DIPHOSPHATE


Type: RNA linking / Mass: 443.201 Da / Num. of mol.: 153 / Source method: obtained synthetically / Formula: C10H15N5O11P2 / Comment: GDP, energy-carrying molecule*YM

+
Details

Has ligand of interestN

-
Experimental details

-
Experiment

ExperimentMethod: ELECTRON MICROSCOPY
EM experimentAggregation state: FILAMENT / 3D reconstruction method: single particle reconstruction

-
Sample preparation

ComponentName: 48-nm repeat of the native axonemal doublet microtubule from bovine sperm
Type: COMPLEX / Entity ID: #1-#66 / Source: NATURAL
Molecular weightExperimental value: NO
Source (natural)Organism: Bos taurus (domestic cattle)
Buffer solutionpH: 7.9
SpecimenEmbedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES
Specimen supportGrid material: COPPER / Grid mesh size: 200 divisions/in. / Grid type: Quantifoil
VitrificationInstrument: HOMEMADE PLUNGER / Cryogen name: ETHANE-PROPANE

-
Electron microscopy imaging

Experimental equipment
Model: Talos Arctica / Image courtesy: FEI Company
MicroscopyModel: FEI TALOS ARCTICA
Electron gunElectron source: FIELD EMISSION GUN / Accelerating voltage: 200 kV / Illumination mode: FLOOD BEAM
Electron lensMode: BRIGHT FIELD / Nominal defocus max: 2500 nm / Nominal defocus min: 500 nm
Specimen holderCryogen: NITROGEN
Image recordingElectron dose: 50 e/Å2 / Detector mode: SUPER-RESOLUTION / Film or detector model: GATAN K2 SUMMIT (4k x 4k)

-
Processing

EM software
IDNameVersionCategory
1RELION3.1particle selection
2SerialEMimage acquisition
4RELION3.1CTF correction
10RELION3.1initial Euler assignment
11RELION3.1final Euler assignment
13RELION3.13D reconstruction
CTF correctionType: PHASE FLIPPING AND AMPLITUDE CORRECTION
Particle selectionNum. of particles selected: 532665
SymmetryPoint symmetry: C1 (asymmetric)
3D reconstructionResolution: 3.6 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 34083 / Symmetry type: POINT

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more