[English] 日本語
Yorodumi
- PDB-8dxb: HIV-1 reverse transcriptase/rilpivirine with bound fragment 5-flu... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 8dxb
TitleHIV-1 reverse transcriptase/rilpivirine with bound fragment 5-fluoroindole-2-carboxylic acid at the NNRTI Adjacent site
Components
  • Reverse transcriptase/ribonuclease H
  • p51 RT
KeywordsTRANSFERASE / HIV-1 reverse transcriptase
Function / homology
Function and homology information


HIV-1 retropepsin / retroviral ribonuclease H / exoribonuclease H / exoribonuclease H activity / host multivesicular body / DNA integration / viral genome integration into host DNA / RNA-directed DNA polymerase / establishment of integrated proviral latency / viral penetration into host nucleus ...HIV-1 retropepsin / retroviral ribonuclease H / exoribonuclease H / exoribonuclease H activity / host multivesicular body / DNA integration / viral genome integration into host DNA / RNA-directed DNA polymerase / establishment of integrated proviral latency / viral penetration into host nucleus / RNA stem-loop binding / RNA-directed DNA polymerase activity / host cell / RNA-DNA hybrid ribonuclease activity / Transferases; Transferring phosphorus-containing groups; Nucleotidyltransferases / symbiont-mediated suppression of host gene expression / viral nucleocapsid / DNA recombination / DNA-directed DNA polymerase / Hydrolases; Acting on ester bonds / aspartic-type endopeptidase activity / DNA-directed DNA polymerase activity / symbiont entry into host cell / lipid binding / host cell nucleus / host cell plasma membrane / structural molecule activity / virion membrane / proteolysis / DNA binding / zinc ion binding / membrane
Similarity search - Function
Reverse transcriptase connection / Reverse transcriptase connection domain / Reverse transcriptase thumb / Reverse transcriptase thumb domain / Integrase Zinc binding domain / Zinc finger integrase-type profile. / Integrase-like, N-terminal / Integrase DNA binding domain / Integrase, C-terminal domain superfamily, retroviral / Integrase, N-terminal zinc-binding domain ...Reverse transcriptase connection / Reverse transcriptase connection domain / Reverse transcriptase thumb / Reverse transcriptase thumb domain / Integrase Zinc binding domain / Zinc finger integrase-type profile. / Integrase-like, N-terminal / Integrase DNA binding domain / Integrase, C-terminal domain superfamily, retroviral / Integrase, N-terminal zinc-binding domain / Integrase, C-terminal, retroviral / Integrase DNA binding domain profile. / Immunodeficiency lentiviral matrix, N-terminal / gag gene protein p17 (matrix protein) / RNase H / Integrase core domain / Integrase, catalytic core / Integrase catalytic domain profile. / Retroviral nucleocapsid Gag protein p24, C-terminal domain / Gag protein p24 C-terminal domain / Retropepsin-like catalytic domain / Matrix protein, lentiviral and alpha-retroviral, N-terminal / Ribonuclease H domain / RNase H type-1 domain profile. / Reverse transcriptase (RNA-dependent DNA polymerase) / Reverse transcriptase domain / Reverse transcriptase (RT) catalytic domain profile. / Retropepsins / Retroviral aspartyl protease / Aspartyl protease, retroviral-type family profile. / Peptidase A2A, retrovirus, catalytic / Retrovirus capsid, C-terminal / Retroviral matrix protein / Retrovirus capsid, N-terminal / zinc finger / Zinc knuckle / Zinc finger, CCHC-type superfamily / Zinc finger, CCHC-type / Zinc finger CCHC-type profile. / Aspartic peptidase, active site / Eukaryotic and viral aspartyl proteases active site. / Ribonuclease H superfamily / Aspartic peptidase domain superfamily / Ribonuclease H-like superfamily / Reverse transcriptase/Diguanylate cyclase domain / DNA/RNA polymerase superfamily
Similarity search - Domain/homology
5-fluoroindole-2-carboxylic acid / Chem-T27 / Gag-Pol polyprotein
Similarity search - Component
Biological speciesHuman immunodeficiency virus type 1 group M subtype B
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2.1 Å
AuthorsChopra, A. / Ruiz, F.X. / Bauman, J.D. / Arnold, E.
Funding support United States, 1items
OrganizationGrant numberCountry
National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID) United States
CitationJournal: J.Med.Chem. / Year: 2023
Title: Halo Library, a Tool for Rapid Identification of Ligand Binding Sites on Proteins Using Crystallographic Fragment Screening.
Authors: Chopra, A. / Bauman, J.D. / Ruiz, F.X. / Arnold, E.
History
DepositionAug 2, 2022Deposition site: RCSB / Processing site: RCSB
Revision 1.0May 31, 2023Provider: repository / Type: Initial release
Revision 1.1Oct 25, 2023Group: Data collection / Refinement description
Category: chem_comp_atom / chem_comp_bond / pdbx_initial_refinement_model

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Reverse transcriptase/ribonuclease H
B: p51 RT
hetero molecules


Theoretical massNumber of molelcules
Total (without water)115,66718
Polymers114,0292
Non-polymers1,63816
Water3,441191
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area8350 Å2
ΔGint-4 kcal/mol
Surface area45650 Å2
MethodPISA
Unit cell
Length a, b, c (Å)162.618, 73.128, 109.240
Angle α, β, γ (deg.)90.000, 100.623, 90.000
Int Tables number5
Space group name H-MC121
Space group name HallC2y
Symmetry operation#1: x,y,z
#2: -x,y,-z
#3: x+1/2,y+1/2,z
#4: -x+1/2,y+1/2,-z

-
Components

-
Protein , 2 types, 2 molecules AB

#1: Protein Reverse transcriptase/ribonuclease H / Exoribonuclease H / p66 RT


Mass: 63989.238 Da / Num. of mol.: 1 / Mutation: K174A, K175A, C282S
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Strain: isolate BH10 / Gene: gag-pol / Production host: Escherichia coli (E. coli)
References: UniProt: P03366, RNA-directed DNA polymerase, DNA-directed DNA polymerase, retroviral ribonuclease H, exoribonuclease H
#2: Protein p51 RT


Mass: 50039.488 Da / Num. of mol.: 1 / Mutation: C280S
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Strain: isolate BH10 / Gene: gag-pol / Production host: Escherichia coli (E. coli) / References: UniProt: P03366

-
Non-polymers , 6 types, 207 molecules

#3: Chemical ChemComp-FIC / 5-fluoroindole-2-carboxylic acid


Mass: 179.148 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: C9H6FNO2 / Feature type: SUBJECT OF INVESTIGATION
#4: Chemical ChemComp-T27 / 4-{[4-({4-[(E)-2-cyanoethenyl]-2,6-dimethylphenyl}amino)pyrimidin-2-yl]amino}benzonitrile / Rilpivirine


Mass: 366.419 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: C22H18N6 / Comment: medication, inhibitor*YM
#5: Chemical
ChemComp-DMS / DIMETHYL SULFOXIDE


Mass: 78.133 Da / Num. of mol.: 9 / Source method: obtained synthetically / Formula: C2H6OS / Comment: DMSO, precipitant*YM
#6: Chemical ChemComp-EDO / 1,2-ETHANEDIOL / ETHYLENE GLYCOL


Mass: 62.068 Da / Num. of mol.: 3 / Source method: obtained synthetically / Formula: C2H6O2
#7: Chemical ChemComp-MG / MAGNESIUM ION


Mass: 24.305 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: Mg
#8: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 191 / Source method: isolated from a natural source / Formula: H2O

-
Details

Has ligand of interestY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.8 Å3/Da / Density % sol: 56.06 %
Crystal growTemperature: 277 K / Method: vapor diffusion, sitting drop / pH: 6.5
Details: PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF ...Details: PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF QSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET WWTEYWQATWIPEWEFVNTPPLVKLWYQ
PH range: 6.4-6.6

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: APS / Beamline: 23-ID-D / Wavelength: 1 Å
DetectorType: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Apr 19, 2019
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1 Å / Relative weight: 1
ReflectionResolution: 2.1→50 Å / Num. obs: 72883 / % possible obs: 98.5 % / Redundancy: 3.8 % / Rmerge(I) obs: 0.049 / Rpim(I) all: 0.029 / Rrim(I) all: 0.057 / Χ2: 1.063 / Net I/σ(I): 9.3 / Num. measured all: 277784
Reflection shell

Diffraction-ID: 1

Resolution (Å)Redundancy (%)Rmerge(I) obsNum. unique obsCC1/2Rpim(I) allRrim(I) allΧ2% possible all
2.1-2.143.80.60635650.7310.3560.7041.06597.7
2.14-2.183.90.50636450.8120.290.5841.09797.6
2.18-2.223.90.44535560.8250.2560.5151.10197.7
2.22-2.263.90.38935990.8660.2250.451.18497.8
2.26-2.313.80.33735850.8880.1970.3911.11797.9
2.31-2.373.70.27636220.9150.1660.3231.09898.1
2.37-2.423.70.2436380.9350.1430.281.05498.1
2.42-2.493.90.20135950.9610.1150.2321.01598.3
2.49-2.563.70.16336010.9690.0970.191.0398.2
2.56-2.653.80.13836250.980.080.1590.99898.4
2.65-2.743.90.11736640.9840.0670.1360.97698.5
2.74-2.853.90.09436180.990.0540.1090.98798.4
2.85-2.983.80.07736490.9920.0450.091.02398.6
2.98-3.143.70.06636520.9930.0390.0771.03999
3.14-3.333.80.05536710.9950.0320.0641.00798.9
3.33-3.593.90.04836660.9960.0280.0561.13199.1
3.59-3.953.90.04136820.9970.0240.0471.02799.2
3.95-4.523.70.03937160.9970.0230.0461.01999.3
4.52-5.73.80.03537330.9980.020.0411.13299.6
5.7-503.70.03538010.9980.020.0411.16699.3

-
Processing

Software
NameVersionClassification
HKL-2000data scaling
PHENIXdev_3051refinement
PDB_EXTRACT3.27data extraction
HKL-2000data reduction
PHENIXphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 4G1Q
Resolution: 2.1→36.56 Å / SU ML: 0.2989 / Cross valid method: FREE R-VALUE / σ(F): 1.35 / Phase error: 27.6265
Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
RfactorNum. reflection% reflection
Rfree0.2349 3821 2.73 %
Rwork0.2129 136312 -
obs0.2135 72874 96.55 %
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL
Displacement parametersBiso mean: 70.69 Å2
Refinement stepCycle: LAST / Resolution: 2.1→36.56 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms7949 0 103 191 8243
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.00328334
X-RAY DIFFRACTIONf_angle_d0.619411326
X-RAY DIFFRACTIONf_chiral_restr0.04521222
X-RAY DIFFRACTIONf_plane_restr0.00391454
X-RAY DIFFRACTIONf_dihedral_angle_d18.59773170
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
2.1-2.120.36521330.33374665X-RAY DIFFRACTION89.62
2.12-2.150.37191380.31165046X-RAY DIFFRACTION96.2
2.15-2.180.31211380.29395025X-RAY DIFFRACTION95.84
2.18-2.210.30981450.29264971X-RAY DIFFRACTION96.04
2.21-2.240.3011370.29555023X-RAY DIFFRACTION96.05
2.24-2.280.31951430.28335098X-RAY DIFFRACTION96.08
2.28-2.320.29691430.28024943X-RAY DIFFRACTION96.34
2.32-2.360.32741390.2685118X-RAY DIFFRACTION96
2.36-2.40.26141370.26974957X-RAY DIFFRACTION95.36
2.4-2.450.26841370.26295009X-RAY DIFFRACTION96.49
2.45-2.50.31021430.26435021X-RAY DIFFRACTION96.31
2.5-2.550.30431390.26855012X-RAY DIFFRACTION95.12
2.55-2.610.32271420.27054987X-RAY DIFFRACTION95.42
2.61-2.670.3381380.26765056X-RAY DIFFRACTION96.74
2.67-2.750.27351410.25875074X-RAY DIFFRACTION97.28
2.75-2.830.27231420.24445083X-RAY DIFFRACTION97.08
2.83-2.920.27321450.2395129X-RAY DIFFRACTION97.56
2.92-3.020.28481440.24765027X-RAY DIFFRACTION96.65
3.02-3.140.24771440.25465074X-RAY DIFFRACTION97.3
3.14-3.290.29261470.23075148X-RAY DIFFRACTION97.96
3.29-3.460.21151430.21775069X-RAY DIFFRACTION96.59
3.46-3.680.20811440.20835168X-RAY DIFFRACTION98.68
3.68-3.960.21871420.18945094X-RAY DIFFRACTION98.37
3.96-4.360.17821470.17245132X-RAY DIFFRACTION97.7
4.36-4.990.17141450.17175133X-RAY DIFFRACTION98.36
4.99-6.280.27971410.18935121X-RAY DIFFRACTION97.73
6.28-36.560.17431440.17135129X-RAY DIFFRACTION97.9
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
10.599063266126-0.3698698873540.0227964609570.2132986228540.5082552129790.6727028984250.244665273442-0.136636766221-0.192034068950.423239893246-0.07397328493220.03107783629830.05694502664120.1764461472670.001771819215930.7257147608720.004811560679470.09246045815950.5574445529920.02017478337150.43645855532346.465585716-15.728440369270.2917751231
2-0.05411815992290.3667311841490.4232375707930.0622794726880.06615627568040.47508554060.3077465919880.00147090240186-0.04180317191460.1972279531540.0616713167387-0.09845624368910.180642658571-0.354627601920.03804156958130.639970143258-0.00184311548775-0.02140572331610.4476727386910.06448538571410.41207942631941.4287991412-19.570091810854.4337466477
30.185079127312-0.2119179069220.1563802329010.06944809290450.1690330807350.2404064269370.121755848394-0.350657601992-0.002352048787080.3048809437250.1944675674810.1299530819940.2999598503230.1124449592850.00678614726620.711219332811-0.05324068734210.06775677668360.5480797091360.04776988706020.37389490242447.8695854631-17.46435786766.5428922086
40.497480840275-0.1008914289770.2235209877630.503227697630.01216907369780.8966121493330.337313933315-0.193737229794-0.4582306198520.4185853699540.0982195128613-0.1263618824860.441535437127-0.0707213712390.04430596304750.612554135471-0.0392493116384-0.1161044428760.4730899931040.03736966195050.53645302870551.1564357631-28.630801016542.9609917049
50.041591403635-0.0463146413490.2272238991640.548674701163-0.2083049026051.440700777160.163135546685-0.0921835564127-0.1734845056440.1611903368030.1301232141890.339081888970.0972603664009-0.3276279157781.79042607636E-80.3563541849840.002349151135220.002719136880460.3918807073570.06807397795090.53793749978529.6427598341-19.565779341824.7094073174
61.23050075078-0.7483728597060.940789920045-0.0225397462989-0.2331961138340.799905940740.0198490557194-0.0862137711647-0.2005185890730.04126879111810.09941281470560.1297118922820.123488146156-0.1814971341460.002631402759890.238464455787-0.01020158857970.03962026434910.3686678063450.01480180195990.43079925077120.88130749182.460094631446.57340201765
70.7759519315140.5655049296470.4311537968380.6531310053560.6369087453941.57140081375-0.159959166105-0.540262721487-0.2583082725710.1086223817520.1184094497850.168902495326-0.22801885881-0.100627049207-0.00372131897170.2894639079480.07032267313050.0373121554270.5009836068420.08061920129030.54836223144115.34508567528.851161063877.52840384234
80.834400236983-0.4363052172060.6810900729711.26051928311-0.6048122322180.862928722678-0.0968744542318-0.0944566120972-0.03357506688630.276628531132-0.08456403222970.108608881908-0.1782540411870.260348515254-0.001180481274190.466711097353-0.0484497462084-0.00139589535380.44746413139-0.008275695174180.34369778273556.36422235691.3033110876836.6827658705
9-0.0312224155553-0.0644845321996-0.02694430051730.152305380149-0.02030311055960.0686962295982-0.1918094865030.1615509227720.7939339875240.1566531015730.04111496477050.103783793259-0.2990153410260.116483299543-0.1159344304320.889591589024-0.193031003889-0.06923285723960.4589416201230.1378922194280.95310130799955.619701471826.030996088833.6859239326
101.14825001783-0.7395461583330.912139812471.823586512790.334448307590.746562216155-0.2155897372810.06307000633850.3080083530880.8604757212310.100479566882-0.149041561117-0.1529965107670.464034937007-0.08621035593380.556133567782-0.204012923749-0.1586876019320.4151493356430.01661290702160.36413983709161.86294316819.0137693239537.4905284398
110.2635995650660.08155832772290.2301516639690.2100291999030.3136710084560.3940330065370.09547882905820.732130773504-0.008944751372030.4147410335040.351937482445-0.6755038464840.7693223644270.7177852862231.119443587620.332420169095-0.7225191415840.06044605818230.8058298661750.6072757749820.72784393943267.840320526719.32426895522.1235565444
120.849813152510.07221662217050.3730329237851.79847057677-0.4381094131681.50914755644-0.1808167261560.09419047286520.2782895396030.25814793497-0.00529183881708-0.0300045741771-0.2779426503590.0599444991635-6.72882923925E-60.346126565156-0.05068159338090.02180034321540.355012972868-0.02460757268530.34670159498832.735749339324.93824871417.76611115569
130.7672482542120.06043271695840.4119000922670.9132771861340.01225945379240.711098656386-0.06880896003290.1021150918620.09628771846040.17579057118-0.1329653128040.10034373536-0.1621859506140.03263866253434.62961266899E-80.4219758497-0.05316339911840.007806516614280.323485612527-0.001752009429750.35610741082343.111687914210.376170456619.9732533478
Refinement TLS group

Refine-ID: X-RAY DIFFRACTION

IDRefine TLS-IDSelection detailsAuth asym-IDLabel asym-IDAuth seq-IDLabel seq-ID
11chain 'A' and (resid -1 through 59 )AA-1 - 591 - 61
22chain 'A' and (resid 60 through 104 )AA60 - 10462 - 106
33chain 'A' and (resid 105 through 155 )AA105 - 155107 - 157
44chain 'A' and (resid 156 through 253 )AA156 - 253158 - 255
55chain 'A' and (resid 254 through 383 )AA254 - 383256 - 385
66chain 'A' and (resid 384 through 499 )AA384 - 499386 - 501
77chain 'A' and (resid 500 through 554 )AA500 - 554502 - 556
88chain 'B' and (resid 5 through 83 )BD5 - 831 - 79
99chain 'B' and (resid 84 through 104 )BD84 - 10480 - 100
1010chain 'B' and (resid 105 through 174 )BD105 - 174101 - 170
1111chain 'B' and (resid 175 through 238 )BD175 - 238171 - 225
1212chain 'B' and (resid 239 through 363 )BD239 - 363226 - 350
1313chain 'B' and (resid 364 through 428 )BD364 - 428351 - 415

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbjlvh1.pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more