+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7wfg | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Subcomplexes A and E in NDH complex from Arabidopsis | |||||||||||||||||||||
Components |
| |||||||||||||||||||||
Keywords | ELECTRON TRANSPORT / Subcomplex A / subcomplex E / supercomplex / Arabidopsis / plant / cyclic electron transport | |||||||||||||||||||||
| Function / homology | Function and homology informationNADH dehydrogenase complex (plastoquinone) assembly / NAD(P)H dehydrogenase complex (plastoquinone) / cellular response to sulfate starvation / thylakoid membrane / NADPH dehydrogenase activity / chloroplast thylakoid / Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions / chloroplast envelope / photosynthetic electron transport in photosystem I / oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor ...NADH dehydrogenase complex (plastoquinone) assembly / NAD(P)H dehydrogenase complex (plastoquinone) / cellular response to sulfate starvation / thylakoid membrane / NADPH dehydrogenase activity / chloroplast thylakoid / Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions / chloroplast envelope / photosynthetic electron transport in photosystem I / oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor / chloroplast stroma / plastid / photosynthesis, light reaction / electron transport coupled proton transport / chloroplast thylakoid membrane / respiratory chain complex I / NADH dehydrogenase (ubiquinone) activity / defense response to fungus / quinone binding / photosynthesis / aerobic respiration / chloroplast / NAD binding / 4 iron, 4 sulfur cluster binding / iron ion binding / plasma membrane Similarity search - Function | |||||||||||||||||||||
| Biological species | ![]() | |||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 4.33 Å | |||||||||||||||||||||
Authors | Pan, X.W. / Li, M. | |||||||||||||||||||||
| Funding support | China, 5items
| |||||||||||||||||||||
Citation | Journal: Mol Plant / Year: 2022Title: Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana. Authors: Xiaodong Su / Duanfang Cao / Xiaowei Pan / Lifang Shi / Zhenfeng Liu / Luca Dall'Osto / Roberto Bassi / Xinzheng Zhang / Mei Li / ![]() Abstract: Cyclic electron transport/flow (CET/CEF) in chloroplasts is a regulatory process essential for the optimization of plant photosynthetic efficiency. A crucial CEF pathway is catalyzed by a membrane- ...Cyclic electron transport/flow (CET/CEF) in chloroplasts is a regulatory process essential for the optimization of plant photosynthetic efficiency. A crucial CEF pathway is catalyzed by a membrane-embedded NADH dehydrogenase-like (NDH) complex that contains at least 29 protein subunits and associates with photosystem I (PSI) to form the NDH-PSI supercomplex. Here, we report the 3.9 Å resolution structure of the Arabidopsis thaliana NDH-PSI (AtNDH-PSI) supercomplex. We constructed structural models for 26 AtNDH subunits, among which 11 are unique to chloroplasts and stabilize the core part of the NDH complex. In the supercomplex, one NDH can bind up to two PSI-light-harvesting complex I (PSI-LHCI) complexes at both sides of its membrane arm. Two minor LHCIs, Lhca5 and Lhca6, each present in one PSI-LHCI, interact with NDH and contribute to supercomplex formation and stabilization. Collectively, our study reveals the structural details of the AtNDH-PSI supercomplex assembly and provides a molecular basis for further investigation of the regulatory mechanism of CEF in plants. | |||||||||||||||||||||
| History |
|
-
Structure visualization
| Movie |
Movie viewer |
|---|---|
| Structure viewer | Molecule: Molmil Jmol/JSmol |
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7wfg.cif.gz | 251.1 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7wfg.ent.gz | 189.2 KB | Display | PDB format |
| PDBx/mmJSON format | 7wfg.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/wf/7wfg ftp://data.pdbj.org/pub/pdb/validation_reports/wf/7wfg | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 32465MC ![]() 7wfdC ![]() 7wfeC ![]() 7wffC ![]() 7wg5C M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-NAD(P)H-quinone oxidoreductase subunit ... , 7 types, 7 molecules HIJKLMN
| #1: Protein | Mass: 45553.637 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: P56753, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
|---|---|
| #2: Protein | Mass: 20107.314 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: P56755, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
| #3: Protein | Mass: 18579.160 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: P56754, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
| #4: Protein | Mass: 25396.270 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: P56756, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
| #5: Protein | Mass: 21987.850 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: Q9CAC5, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
| #6: Protein | Mass: 24820.828 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: Q2V2S7, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
| #7: Protein | Mass: 23430.254 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: Q9LVM2, Translocases; Catalysing the translocation of protons; Linked to oxidoreductase reactions |
-Protein , 2 types, 2 molecules OT
| #8: Protein | Mass: 17679.381 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #9: Protein | Mass: 10400.812 Da / Num. of mol.: 1 / Source method: isolated from a natural source Details: All Residues in NdhT were modeled as UNK. The real sequence of the entity is: ...Details: All Residues in NdhT were modeled as UNK. The real sequence of the entity is: MAYATSTYARTSCIILPKIQNGAHFTDNTKAFRRITARRVTRISSQGPTKPPKPSPGVDTRIHWESPDEGWIGGRSDPAKSVDEDKTNLLSDEKFAELIKDSFDSHYQFLGVSTDAHLEEIKSAYRRLSKEYHPDTTSLPLKTASEKFMKLREVYNVLSDEETRRFYDWTLAQEVASRQAEKMRMKLEDPKEQDFRGYESIPDMVDRLGGRNMELSDQAMTALTFDILIVLFAVCCIVFVIVFKDPSY Source: (natural) ![]() |
-Non-polymers , 1 types, 3 molecules 
| #10: Chemical |
|---|
-Details
| Has ligand of interest | Y |
|---|---|
| Has protein modification | N |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Subcomplex A and E in NDH complex from Arabidopsis / Type: COMPLEX / Entity ID: #1-#9 / Source: NATURAL |
|---|---|
| Source (natural) | Organism: ![]() |
| Buffer solution | pH: 7.8 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2500 nm / Nominal defocus min: 1500 nm |
| Image recording | Electron dose: 60 e/Å2 / Detector mode: SUPER-RESOLUTION / Film or detector model: GATAN K2 SUMMIT (4k x 4k) |
-
Processing
| Software | Name: PHENIX / Version: 1.17.1_3660: / Classification: refinement | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EM software | Name: PHENIX / Category: model refinement | ||||||||||||||||||||||||
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 4.33 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 76085 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi






China, 5items
Citation
UCSF Chimera
















PDBj









