+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7s47 | ||||||
|---|---|---|---|---|---|---|---|
| Title | Integrin beta5(743-774)-linker-PAK4cat(D440N/S474E) | ||||||
Components |
| ||||||
Keywords | TRANSFERASE / serine/threonine kinase | ||||||
| Function / homology | Function and homology informationepithelial cell-cell adhesion / integrin alphav-beta5 complex / Cross-presentation of particulate exogenous antigens (phagosomes) / wound healing, spreading of epidermal cells / integrin complex / Molecules associated with elastic fibres / cell adhesion mediated by integrin / endodermal cell differentiation / Syndecan interactions / stress fiber assembly ...epithelial cell-cell adhesion / integrin alphav-beta5 complex / Cross-presentation of particulate exogenous antigens (phagosomes) / wound healing, spreading of epidermal cells / integrin complex / Molecules associated with elastic fibres / cell adhesion mediated by integrin / endodermal cell differentiation / Syndecan interactions / stress fiber assembly / TGF-beta receptor signaling activates SMADs / Smooth Muscle Contraction / Integrin cell surface interactions / ECM proteoglycans / transforming growth factor beta receptor signaling pathway / phagocytic vesicle / cell-matrix adhesion / integrin-mediated signaling pathway / cell-cell adhesion / integrin binding / cell migration / virus receptor activity / non-specific serine/threonine protein kinase / signaling receptor complex / focal adhesion / cell surface / extracellular exosome / metal ion binding / plasma membrane Similarity search - Function | ||||||
| Biological species | Homo sapiens (human) | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2 Å | ||||||
Authors | Ha, B.H. / Boggon, T.J. | ||||||
| Funding support | United States, 1items
| ||||||
Citation | Journal: Commun Biol / Year: 2022Title: Molecular basis for integrin adhesion receptor binding to p21-activated kinase 4 (PAK4) Authors: Ha, B.H. / Yigit, S. / Natarajan, N. / Morse, E.M. / Calderwood, D.A. / Boggon, T.J. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7s47.cif.gz | 137.6 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7s47.ent.gz | 103.5 KB | Display | PDB format |
| PDBx/mmJSON format | 7s47.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/s4/7s47 ftp://data.pdbj.org/pub/pdb/validation_reports/s4/7s47 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 7s46C ![]() 7s48C ![]() 4fifS S: Starting model for refinement C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||
|---|---|---|---|---|---|---|---|---|---|
| 1 |
| ||||||||
| Unit cell |
|
-
Components
| #1: Protein | Mass: 43060.586 Da / Num. of mol.: 1 / Mutation: D440N,S474E Source method: isolated from a genetically manipulated source Details: Chimeric protein of Integrin beta 5 (743-744-SSGSSGSS GSSG-PAK4 kinase (109-426) Source: (gene. exp.) Homo sapiens (human) / Gene: ITGB5, PAK4, KIAA1142 / Production host: ![]() References: UniProt: P18084, UniProt: O96013-2, non-specific serine/threonine protein kinase |
|---|---|
| #2: Protein/peptide | Mass: 3921.489 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: Integrin beta 5 cytosolic domain ( 743- KLLVTIHDRREFAKFQSERSRARYEMASNPLY-774 ) Source: (gene. exp.) Homo sapiens (human) / Gene: ITGB5 / Production host: ![]() |
| #3: Chemical | ChemComp-ANP / |
| #4: Water | ChemComp-HOH / |
| Has ligand of interest | Y |
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 1.85 Å3/Da / Density % sol: 33.36 % |
|---|---|
| Crystal grow | Temperature: 293 K / Method: vapor diffusion, hanging drop Details: 100 mM sodium acetate pH 4.0, 0.7 M diammonium phosphate |
-Data collection
| Diffraction | Mean temperature: 100 K / Serial crystal experiment: N | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: APS / Beamline: 24-ID-E / Wavelength: 0.97918 Å | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Detector | Type: ADSC QUANTUM 315 / Detector: CCD / Date: Mar 30, 2017 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Radiation wavelength | Wavelength: 0.97918 Å / Relative weight: 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reflection | Resolution: 2→50.01 Å / Num. obs: 24672 / % possible obs: 99.8 % / Redundancy: 8.8 % / Rmerge(I) obs: 0.166 / Rpim(I) all: 0.059 / Rrim(I) all: 0.176 / Χ2: 0.993 / Net I/σ(I): 8.8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reflection shell | Diffraction-ID: 1
|
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 4FIF Resolution: 2→50.01 Å / Cor.coef. Fo:Fc: 0.957 / Cor.coef. Fo:Fc free: 0.935 / SU B: 9.125 / SU ML: 0.119 / Cross valid method: THROUGHOUT / σ(F): 0 / ESU R: 0.169 / ESU R Free: 0.157 / Stereochemistry target values: MAXIMUM LIKELIHOOD Details: U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso max: 81.63 Å2 / Biso mean: 36.138 Å2 / Biso min: 18.66 Å2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: final / Resolution: 2→50.01 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell | Resolution: 2.001→2.053 Å / Rfactor Rfree error: 0 / Total num. of bins used: 20
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS params. | Method: refined / Refine-ID: X-RAY DIFFRACTION
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS group |
|
Movie
Controller
About Yorodumi




Homo sapiens (human)
X-RAY DIFFRACTION
United States, 1items
Citation


PDBj

























