+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7qbd | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Title | TC:CD320 in complex with nanobody TC-Nb26 | |||||||||
Components |
| |||||||||
Keywords | TRANSPORT PROTEIN / Transcobalamin / TC2 / CD320 / TCblR / B12 / nanobody | |||||||||
| Function / homology | Function and homology informationDefective TCN2 causes TCN2 deficiency / Defective CD320 causes MMATC / B cell costimulation / cargo receptor ligand activity / Transport of RCbl within the body / cobalt ion transport / cobalamin transport / cobalamin binding / cargo receptor activity / molecular carrier activity ...Defective TCN2 causes TCN2 deficiency / Defective CD320 causes MMATC / B cell costimulation / cargo receptor ligand activity / Transport of RCbl within the body / cobalt ion transport / cobalamin transport / cobalamin binding / cargo receptor activity / molecular carrier activity / positive regulation of B cell proliferation / lysosomal lumen / growth factor activity / external side of plasma membrane / calcium ion binding / endoplasmic reticulum / : / extracellular region / membrane / metal ion binding / plasma membrane Similarity search - Function | |||||||||
| Biological species | Homo sapiens (human)![]() | |||||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 4.18 Å | |||||||||
Authors | Bloch, J.S. / Locher, K.P. | |||||||||
| Funding support | Switzerland, 1items
| |||||||||
Citation | Journal: Faseb J. / Year: 2022Title: Generation of nanobodies targeting the human, transcobalamin-mediated vitamin B 12 uptake route. Authors: Bloch, J.S. / Sequeira, J.M. / Ramirez, A.S. / Quadros, E.V. / Locher, K.P. | |||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7qbd.cif.gz | 229.6 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7qbd.ent.gz | 177.4 KB | Display | PDB format |
| PDBx/mmJSON format | 7qbd.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/qb/7qbd ftp://data.pdbj.org/pub/pdb/validation_reports/qb/7qbd | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 7qbeC ![]() 7qbfC ![]() 7qbgC ![]() 4zrpS S: Starting model for refinement C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||||||
| 2 | ![]()
| ||||||||||||
| Unit cell |
|
-
Components
| #1: Protein | Mass: 45650.426 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: TCN2, TC2 / Production host: ![]() #2: Protein | Mass: 15613.506 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: CD320, 8D6A, UNQ198/PRO224 / Production host: ![]() #3: Antibody | | Mass: 14768.259 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: QVQLVESGGGLVQAGESLRLSCAASGRT FAMAWFRQAPGKEREFVAVRGWLGVTTYYADSVKGRFTISRDNAKNTLDL QMNSLKPEDTAVYYCAAGQYSSSLYDRETEYNYWGQGTRVTVSSHHHHHH EPEA Source: (gene. exp.) ![]() ![]() #4: Chemical | #5: Chemical | ChemComp-CA / Has ligand of interest | N | Has protein modification | Y | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 3.95 Å3/Da / Density % sol: 68.89 % |
|---|---|
| Crystal grow | Temperature: 297.15 K / Method: vapor diffusion, sitting drop Details: 150 mM Ammonium citrate tribasic pH 7.0, 21% w/v PEG 3350 |
-Data collection
| Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: SLS / Beamline: X06SA / Wavelength: 1 Å |
| Detector | Type: DECTRIS EIGER X 16M / Detector: PIXEL / Date: Mar 11, 2016 |
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 1 Å / Relative weight: 1 |
| Reflection | Resolution: 4.18→49.24 Å / Num. obs: 28382 / % possible obs: 94.99 % / Redundancy: 2 % / Biso Wilson estimate: 164.22 Å2 / CC1/2: 0.999 / Net I/σ(I): 10.17 |
| Reflection shell | Resolution: 4.18→4.33 Å / Num. unique obs: 1406 / CC1/2: 0.851 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 4ZRP Resolution: 4.18→49.14 Å / SU ML: 0.6154 / Cross valid method: FREE R-VALUE / σ(F): 1.35 / Phase error: 35.4595 Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 192.11 Å2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 4.18→49.14 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell |
|
Movie
Controller
About Yorodumi




Homo sapiens (human)
X-RAY DIFFRACTION
Switzerland, 1items
Citation













PDBj












