[English] 日本語
Yorodumi
- PDB-7ojn: Lassa virus L protein in an elongation conformation [ELONGATION] -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 7ojn
TitleLassa virus L protein in an elongation conformation [ELONGATION]
Components
  • 3' RNA
  • 5' RNA
  • RNA-directed RNA polymerase L
  • product RNA
KeywordsVIRAL PROTEIN / Lassa virus RNA-dependent RNA polymerase viral RNA
Function / homology
Function and homology information


negative stranded viral RNA replication / cap snatching / host cell / Hydrolases; Acting on ester bonds / hydrolase activity / nucleotide binding / host cell cytoplasm / RNA-directed RNA polymerase / RNA-directed RNA polymerase activity / metal ion binding
Similarity search - Function
RNA polymerase, arenaviral / RNA endonuclease, cap-snatching / Arenavirus RNA polymerase / Arenavirus cap snatching domain / : / RNA-directed RNA polymerase, negative-strand RNA virus / RdRp of negative ssRNA viruses with segmented genomes catalytic domain profile.
Similarity search - Domain/homology
Chem-2KH / : / RNA / RNA (> 10) / RNA-directed RNA polymerase L
Similarity search - Component
Biological speciesLassa mammarenavirus
MethodELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 2.92 Å
AuthorsKouba, T. / Vogel, D. / Thorkelsson, S. / Quemin, E. / Williams, H.M. / Milewski, M. / Busch, C. / Gunther, S. / Grunewald, K. / Rosenthal, M. / Cusack, S.
Funding support Germany, 2items
OrganizationGrant numberCountry
Leibniz AssociationK27/2017 Germany
German Research Foundation (DFG)INST 152/777-1 FUGG Germany
CitationJournal: Nat Commun / Year: 2021
Title: Conformational changes in Lassa virus L protein associated with promoter binding and RNA synthesis activity.
Authors: Tomas Kouba / Dominik Vogel / Sigurdur R Thorkelsson / Emmanuelle R J Quemin / Harry M Williams / Morlin Milewski / Carola Busch / Stephan Günther / Kay Grünewald / Maria Rosenthal / Stephen Cusack /
Abstract: Lassa virus is endemic in West Africa and can cause severe hemorrhagic fever. The viral L protein transcribes and replicates the RNA genome via its RNA-dependent RNA polymerase activity. Here, we ...Lassa virus is endemic in West Africa and can cause severe hemorrhagic fever. The viral L protein transcribes and replicates the RNA genome via its RNA-dependent RNA polymerase activity. Here, we present nine cryo-EM structures of the L protein in the apo-, promoter-bound pre-initiation and active RNA synthesis states. We characterize distinct binding pockets for the conserved 3' and 5' promoter RNAs and show how full-promoter binding induces a distinct pre-initiation conformation. In the apo- and early elongation states, the endonuclease is inhibited by two distinct L protein peptides, whereas in the pre-initiation state it is uninhibited. In the early elongation state, a template-product duplex is bound in the active site cavity together with an incoming non-hydrolysable nucleotide and the full C-terminal region of the L protein, including the putative cap-binding domain, is well-ordered. These data advance our mechanistic understanding of how this flexible and multifunctional molecular machine is activated.
History
DepositionMay 16, 2021Deposition site: PDBE / Processing site: PDBE
Revision 1.0Dec 1, 2021Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: EM metadata / Data content type: EM metadata / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Additional map / Data content type: Additional map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: FSC / Data content type: FSC / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 1 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 2 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Image / Data content type: Image / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Primary map / Data content type: Primary map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Additional map / Data content type: Additional map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: FSC / Data content type: FSC / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 1 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 2 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Image / Data content type: Image / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Primary map / Data content type: Primary map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Additional map / Data content type: Additional map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: FSC / Data content type: FSC / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 1 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Half map / Part number: 2 / Data content type: Half map / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Image / Data content type: Image / Provider: repository / Type: Initial release
Revision 1.0Dec 1, 2021Data content type: Primary map / Data content type: Primary map / Provider: repository / Type: Initial release
Revision 1.1Dec 22, 2021Group: Database references / Category: citation / citation_author
Item: _citation.country / _citation.journal_abbrev ..._citation.country / _citation.journal_abbrev / _citation.journal_id_CSD / _citation.journal_id_ISSN / _citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_DOI / _citation.pdbx_database_id_PubMed / _citation.title / _citation.year / _citation_author.identifier_ORCID / _citation_author.name
Revision 1.2May 1, 2024Group: Data collection / Structure summary / Category: audit_author / chem_comp_atom / chem_comp_bond / Item: _audit_author.name
Revision 1.3Jul 2, 2025Group: Data collection / Structure summary / Category: em_admin / em_software / pdbx_entry_details
Item: _em_admin.last_update / _em_software.name / _pdbx_entry_details.has_protein_modification
Revision 1.1Jul 2, 2025Data content type: EM metadata / Data content type: EM metadata / EM metadata / Group: Data processing / Experimental summary / Data content type: EM metadata / EM metadata / Category: em_admin / em_software / Data content type: EM metadata / EM metadata / Item: _em_admin.last_update / _em_software.name

-
Structure visualization

Movie
  • Deposited structure unit
  • Imaged by Jmol
  • Download
  • Superimposition on EM map
  • EMDB-12956
  • Imaged by UCSF Chimera
  • Download
Movie viewer
Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
L: RNA-directed RNA polymerase L
D: 5' RNA
R: 3' RNA
M: product RNA
E: 3' RNA
hetero molecules


Theoretical massNumber of molelcules
Total (without water)275,92712
Polymers275,1045
Non-polymers8237
Water00
1


  • Idetical with deposited unit
  • defined by author
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_5551

-
Components

-
Protein , 1 types, 1 molecules L

#1: Protein RNA-directed RNA polymerase L / Protein L / Large structural protein / Replicase / Transcriptase


Mass: 253656.938 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: MEDDMACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILT PSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKL ...Details: MEDDMACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILT PSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKL RDTLFSLLRYAQESNSLFEESEYSRLCESLSMTSGRLSGVESLNVLLDNRSSHYEEIIASCHQGINNKLTAHEVKLQIEE EYQVFRNRLRKGEITGQFLKVDKSRLLNDFNNLYVDEVTATKDNIEHLIYQFKRASPILRFLYANIGEGNGEERHHTIKE CQMQYWRSFLNKVKSLRILNTRRKLLLIFDALILLASIHDQTRHKCSKGWLGSCFISVNDRLVSLESTKRDLEKWVGRRQ QSERSNTIQPPDKNQILISMFQKTILKATAALKDVGISVEHYKINMEVICPDSYDLILNFDVSGVVPTISYQRTEDEKFP FIMGGVELLESTDLERLSSLSLALVNSMKTSSTVKLRQNEFGPARYQVVRCKEAYCQEFLLSGAEFQLIYQKTGECSKCY AINDNRVGEICSFYADPKRYFPAIFSAEVLQTTVSTMISWVKDCSELEEQLCNINSLTKMILVLILAHPSKRSQKLLQNL RYFIMAYVSDYHHKDLIDKLREELITDVEFLLYRLVRALVNLILSEDVKSMMTNRFKFILNISYMCHFITKETPDRLTDQ IKCFEKFLEPKLEFGHVSINPADVATEEELDDMVYNAKKFLSKEGCTSIKGPDYKKPGVSKRFLSLLTSSFNNGSLFKES EVKREIKDPLVTSGCATALDLASNKSVVVNKYTDGSRVLNYDFNKLTALAVSQLTEVFSRKGKHLLNKQDYDYKVQQAMS NLVLGPRQNKVGADEADLDEILLDGGASVYFDQLKETVERIIDQYREPVKPGSNPNGGDQPSVNDLDEVVPNKFYIRLIK GELSNHMVEDFDYDVLPGNFYEEFCDAVYKNNKLKERYFYCGQMSQCPIGELTKAVATRTYFDQEYFQCFKSILLIMNAN TLMGRYTHYKSRNLNFKFDMGRLSDDVRISERESNSEALSKALSLTNCTTAMLKNLCFYSQESPQSYSSTGPDTGRLKFS LSYKEQVGGNRELYIGDLRTKMFTRLIEDYFEALSLQLSGSCLNNEREFENAILSMKLNVSLAHVSYSMDHSKWGPMMCP FLFLATLQNLIFLSKDLQADIKGRDYLSTLLTWHMHKMVEIPFNVVSAMMKSFIKAQLGLKKKTTQSITEDFFYSNFQIG VVPSHVSSILDMGQGILHNTSDFYALISERFINYAISCICGGTIDAYTSSDDQISLFDQVLTELMQRDPEEFKTLIEFHY YMSDQLNKFVSPKSVIGRFVAEFKSRFYVWGDEVPLLTKFVAAALHNIKCKEPHQLAETIDTIIDQSVANGVPVHLCNLI QKRTLSLLQYARYPIDPFLLNCETDVRDWVDGNRSYRIMRQIERLIPDACGRIRSMLRKLYNKLKTGQLHEEFTTNYLSS EHLSSLSNLCELLGVEPPSESDLEFSWLNLAAHHPLRMVLRQKIIYSGAVNLDDEKVPTIVKTIQNKLSSTFTRGAQKLL SEAINKSAFQSSIASGFVGLCRTLGSKCVRGPNKESLYIKSIQSLISDIQGIEPLIDSHGVQYWRVPLNIRDGNEGVISY FRPLLWDYMCISLSTAIELGAWVLGEPKKVRVLEFFKHNPCDYFPLKPAASKLLEDRVGLNHIIHSLRRLYPSVFEKHIL PFMSDLASTKMKWSPRIKFLDLCVALDVNCEALSLVSHIVKWKREEHYIVLSSELRLSHTRTHEPMVEERVVSTSDAVDN FMRQIYFESYVRSFVATTRTLGSFTWFPHKTSVPEGEGLQRLGPFSSFVEKAIHKGIERPMFKHDLMMGYAWIDFDIEPA RFNHNQLIASGLVGPRFDSLEDFFDAVESLPPGSAKLSQTVRFRIKSQDASFKESFAIHLDYTGSINQQTKYLVHEVSAM YSGAVSPCVLSDCWRLVLSGPTFKGKSAWYVDTEIVNEFLTDTNQLGHVTPVEIVVDMEKLQFTEYDFVLVGPCVEPVPL VVHRGGLWECDKKLASFTPVVQDQDLEMFVKEVGDSSLDLLIGALSAMILDRLKLRMQWSEVDIVSMLKAAMPSNSVKVL NAVLEAVDDWVDFKGYALCYSKSRKKVMVHSSGGKLRLKGRTCEELVKEDEGIEDIE
Source: (gene. exp.) Lassa mammarenavirus / Production host: Trichoplusia ni (cabbage looper)
References: UniProt: A0A3S8NV63, RNA-directed RNA polymerase, Hydrolases; Acting on ester bonds

-
RNA chain , 3 types, 4 molecules DREM

#2: RNA chain 5' RNA


Mass: 6452.911 Da / Num. of mol.: 1 / Source method: obtained synthetically / Source: (synth.) Lassa mammarenavirus
#3: RNA chain 3' RNA


Mass: 6069.649 Da / Num. of mol.: 2 / Source method: obtained synthetically / Source: (synth.) Lassa mammarenavirus
#4: RNA chain product RNA


Mass: 2854.782 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Lassa mammarenavirus

-
Non-polymers , 3 types, 7 molecules

#5: Chemical ChemComp-2KH / 5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]uridine


Mass: 483.156 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: C9H16N3O14P3 / Feature type: SUBJECT OF INVESTIGATION
#6: Chemical
ChemComp-MN / MANGANESE (II) ION


Mass: 54.938 Da / Num. of mol.: 5 / Source method: obtained synthetically / Formula: Mn
#7: Chemical ChemComp-ZN / ZINC ION


Mass: 65.409 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: Zn

-
Details

Has ligand of interestY
Has protein modificationN

-
Experimental details

-
Experiment

ExperimentMethod: ELECTRON MICROSCOPY
EM experimentAggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction

-
Sample preparation

Component
IDNameTypeEntity IDParent-IDSource
1RNA-directed RNA polymerase L Lassa mammarenavirusCOMPLEX#1-#40MULTIPLE SOURCES
2RNA-directed RNA polymerase LCOMPLEX#11RECOMBINANT
35' RNA, 3' RNACOMPLEX#2-#31RECOMBINANT
4product RNACOMPLEX#41NATURAL
Molecular weightValue: 0.253346 MDa / Experimental value: NO
Source (natural)
IDEntity assembly-IDOrganismNcbi tax-ID
22Lassa mammarenavirus11620
33Lassa mammarenavirus11620
44Lassa mammarenavirus11620
Source (recombinant)
IDEntity assembly-IDOrganismNcbi tax-ID
22Trichoplusia ni (cabbage looper)7111
33synthetic construct (others)32630
Buffer solutionpH: 7
SpecimenEmbedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES
VitrificationCryogen name: ETHANE

-
Electron microscopy imaging

Experimental equipment
Model: Titan Krios / Image courtesy: FEI Company
MicroscopyModel: FEI TITAN KRIOS
Electron gunElectron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM
Electron lensMode: BRIGHT FIELD
Image recordingElectron dose: 49.5 e/Å2 / Film or detector model: GATAN K3 (6k x 4k)

-
Processing

SoftwareName: PHENIX / Version: 1.19.2_4158: / Classification: refinement
EM softwareName: PHENIX / Category: model refinement
CTF correctionType: PHASE FLIPPING AND AMPLITUDE CORRECTION
3D reconstructionResolution: 2.92 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 79600 / Symmetry type: POINT
Refine LS restraints
Refine-IDTypeDev idealNumber
ELECTRON MICROSCOPYf_bond_d0.00217392
ELECTRON MICROSCOPYf_angle_d0.3923672
ELECTRON MICROSCOPYf_dihedral_angle_d9.3456613
ELECTRON MICROSCOPYf_chiral_restr0.0362707
ELECTRON MICROSCOPYf_plane_restr0.0032855

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more