[English] 日本語
Yorodumi
- PDB-7ael: alpha 1-antitrypsin (C232S) complexed with GSK716 -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 7ael
Titlealpha 1-antitrypsin (C232S) complexed with GSK716
ComponentsAlpha-1-antitrypsin
KeywordsPROTEIN BINDING / SERPIN / SERINE PROTEASE INHIBITOR
Function / homology
Function and homology information


Cargo concentration in the ER / COPII-coated ER to Golgi transport vesicle / COPII-mediated vesicle transport / endoplasmic reticulum-Golgi intermediate compartment membrane / platelet alpha granule lumen / acute-phase response / Post-translational protein phosphorylation / serine-type endopeptidase inhibitor activity / Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) / blood coagulation ...Cargo concentration in the ER / COPII-coated ER to Golgi transport vesicle / COPII-mediated vesicle transport / endoplasmic reticulum-Golgi intermediate compartment membrane / platelet alpha granule lumen / acute-phase response / Post-translational protein phosphorylation / serine-type endopeptidase inhibitor activity / Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) / blood coagulation / Platelet degranulation / extracellular matrix / protease binding / ficolin-1-rich granule lumen / endoplasmic reticulum lumen / Neutrophil degranulation / endoplasmic reticulum / Golgi apparatus / : / extracellular exosome / extracellular region / identical protein binding
Similarity search - Function
Serpin, conserved site / Serpins signature. / Serpin superfamily, domain 2 / Serpin family / Serpin domain / Serpin superfamily / Serpin superfamily, domain 1 / Serpin (serine protease inhibitor) / SERine Proteinase INhibitors
Similarity search - Domain/homology
Chem-R7Z / Alpha-1-antitrypsin
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.76 Å
AuthorsChung, C.
CitationJournal: Embo Mol Med / Year: 2021
Title: Development of a small molecule that corrects misfolding and increases secretion of Z alpha 1 -antitrypsin.
Authors: Lomas, D.A. / Irving, J.A. / Arico-Muendel, C. / Belyanskaya, S. / Brewster, A. / Brown, M. / Chung, C.W. / Dave, H. / Denis, A. / Dodic, N. / Dossang, A. / Eddershaw, P. / Klimaszewska, D. ...Authors: Lomas, D.A. / Irving, J.A. / Arico-Muendel, C. / Belyanskaya, S. / Brewster, A. / Brown, M. / Chung, C.W. / Dave, H. / Denis, A. / Dodic, N. / Dossang, A. / Eddershaw, P. / Klimaszewska, D. / Haq, I. / Holmes, D.S. / Hutchinson, J.P. / Jagger, A.M. / Jakhria, T. / Jigorel, E. / Liddle, J. / Lind, K. / Marciniak, S.J. / Messer, J. / Neu, M. / Olszewski, A. / Ordonez, A. / Ronzoni, R. / Rowedder, J. / Rudiger, M. / Skinner, S. / Smith, K.J. / Terry, R. / Trottet, L. / Uings, I. / Wilson, S. / Zhu, Z. / Pearce, A.C.
History
DepositionSep 17, 2020Deposition site: PDBE / Processing site: PDBE
Revision 1.0Mar 10, 2021Provider: repository / Type: Initial release
Revision 1.1Mar 17, 2021Group: Database references / Category: citation / Item: _citation.journal_volume
Revision 1.2May 1, 2024Group: Data collection / Database references ...Data collection / Database references / Derived calculations / Refinement description
Category: atom_type / chem_comp_atom ...atom_type / chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model
Item: _atom_type.pdbx_N_electrons / _atom_type.pdbx_scat_Z ..._atom_type.pdbx_N_electrons / _atom_type.pdbx_scat_Z / _database_2.pdbx_DOI / _database_2.pdbx_database_accession

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
AAA: Alpha-1-antitrypsin
hetero molecules


Theoretical massNumber of molelcules
Total (without water)46,0623
Polymers45,5961
Non-polymers4662
Water5,206289
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area240 Å2
ΔGint-19 kcal/mol
Surface area16410 Å2
MethodPISA
Unit cell
Length a, b, c (Å)113.954, 39.592, 90.517
Angle α, β, γ (deg.)90.000, 104.961, 90.000
Int Tables number5
Space group name H-MC121

-
Components

#1: Protein Alpha-1-antitrypsin / Alpha-1 protease inhibitor / Alpha-1-antiproteinase / Serpin A1


Mass: 45595.680 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: TFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLN FNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSE AFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVK ...Details: TFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLN FNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSE AFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVK DTEEEDFHVDQVTTVKVPMMKRLGMFNIQHSKKLSSWVLLMKYLGNATAIFFLPDEGKLQ HLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGV TEEAPLKLSKAVHKAVLTIDPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQ
Source: (gene. exp.) Homo sapiens (human) / Gene: SERPINA1, AAT, PI, PRO0684, PRO2209 / Production host: Escherichia coli (E. coli) / References: UniProt: P01009
#2: Chemical ChemComp-R7Z / ~{N}-[(1~{S},2~{R})-1-(3-fluoranyl-2-methyl-phenyl)-1-oxidanyl-pentan-2-yl]-2-oxidanylidene-1,3-dihydroindole-4-carboxamide


Mass: 370.417 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: C21H23FN2O3
#3: Chemical ChemComp-SO4 / SULFATE ION


Mass: 96.063 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: SO4
#4: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 289 / Source method: isolated from a natural source / Formula: H2O
Has ligand of interestY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.44 Å3/Da / Density % sol: 49.62 %
Crystal growTemperature: 293 K / Method: vapor diffusion / Details: 22% PEG1500, 0.2M MES pH 6.0

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: Diamond / Beamline: I03 / Wavelength: 0.9763 Å
DetectorType: DECTRIS PILATUS3 S 6M / Detector: PIXEL / Date: Feb 10, 2017
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.9763 Å / Relative weight: 1
ReflectionResolution: 1.76→55.05 Å / Num. obs: 38875 / % possible obs: 99.2 % / Redundancy: 3.3 % / CC1/2: 0.999 / Net I/σ(I): 19.61
Reflection shellResolution: 1.76→1.823 Å / Rmerge(I) obs: 0.5007 / Num. unique obs: 3853 / CC1/2: 0.805

-
Processing

Software
NameVersionClassification
REFMAC5.8.0258refinement
XDSdata reduction
Aimlessdata scaling
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: internal

Resolution: 1.76→55.05 Å / Cor.coef. Fo:Fc: 0.969 / Cor.coef. Fo:Fc free: 0.955 / SU B: 2.835 / SU ML: 0.088 / Cross valid method: FREE R-VALUE / ESU R: 0.123 / ESU R Free: 0.118
Details: Hydrogens have been added in their riding positions
RfactorNum. reflection% reflection
Rfree0.2239 1916 4.929 %
Rwork0.1893 36959 -
all0.191 --
obs-38875 98.914 %
Solvent computationIon probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: BABINET MODEL PLUS MASK
Displacement parametersBiso mean: 41.746 Å2
Baniso -1Baniso -2Baniso -3
1--0.974 Å20 Å20.712 Å2
2--1.199 Å20 Å2
3----0.53 Å2
Refinement stepCycle: LAST / Resolution: 1.76→55.05 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms2837 0 32 289 3158
Refine LS restraints
Refine-IDTypeDev idealDev ideal targetNumber
X-RAY DIFFRACTIONr_bond_refined_d0.0040.0132964
X-RAY DIFFRACTIONr_bond_other_d0.0010.0172774
X-RAY DIFFRACTIONr_angle_refined_deg1.2251.6384014
X-RAY DIFFRACTIONr_angle_other_deg1.2341.5846476
X-RAY DIFFRACTIONr_dihedral_angle_1_deg6.3985363
X-RAY DIFFRACTIONr_dihedral_angle_2_deg35.425.036137
X-RAY DIFFRACTIONr_dihedral_angle_3_deg12.57415537
X-RAY DIFFRACTIONr_dihedral_angle_4_deg18.296156
X-RAY DIFFRACTIONr_chiral_restr0.0560.2389
X-RAY DIFFRACTIONr_gen_planes_refined0.0050.023250
X-RAY DIFFRACTIONr_gen_planes_other0.0010.02573
X-RAY DIFFRACTIONr_nbd_refined0.1930.2481
X-RAY DIFFRACTIONr_symmetry_nbd_other0.1670.22441
X-RAY DIFFRACTIONr_nbtor_refined0.1580.21395
X-RAY DIFFRACTIONr_symmetry_nbtor_other0.0740.21227
X-RAY DIFFRACTIONr_xyhbond_nbd_refined0.1530.2156
X-RAY DIFFRACTIONr_symmetry_nbd_refined0.1270.28
X-RAY DIFFRACTIONr_nbd_other0.2050.229
X-RAY DIFFRACTIONr_symmetry_xyhbond_nbd_refined0.180.26
X-RAY DIFFRACTIONr_mcbond_it2.9445.4731446
X-RAY DIFFRACTIONr_mcbond_other2.9455.4691445
X-RAY DIFFRACTIONr_mcangle_it4.03312.281811
X-RAY DIFFRACTIONr_mcangle_other4.03212.2871812
X-RAY DIFFRACTIONr_scbond_it4.1136.1631518
X-RAY DIFFRACTIONr_scbond_other4.1156.1641515
X-RAY DIFFRACTIONr_scangle_it6.55513.4382203
X-RAY DIFFRACTIONr_scangle_other6.5613.4412198
X-RAY DIFFRACTIONr_lrange_it7.96249.7323141
X-RAY DIFFRACTIONr_lrange_other7.96149.7233142
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
1.76-1.8040.321310.282727X-RAY DIFFRACTION98.6878
1.804-1.8540.2561380.252620X-RAY DIFFRACTION98.924
1.854-1.9070.2591380.2332590X-RAY DIFFRACTION99.1639
1.907-1.9660.2561290.2242503X-RAY DIFFRACTION99.0964
1.966-2.030.2181130.2052403X-RAY DIFFRACTION99.1332
2.03-2.1020.2511310.2142377X-RAY DIFFRACTION99.2089
2.102-2.1810.2351310.212224X-RAY DIFFRACTION98.9912
2.181-2.270.214950.1952204X-RAY DIFFRACTION99.0948
2.27-2.3710.2161070.1932089X-RAY DIFFRACTION99.3216
2.371-2.4860.2671070.1882023X-RAY DIFFRACTION99.1159
2.486-2.6210.2411070.1891902X-RAY DIFFRACTION99.112
2.621-2.7790.2960.1831792X-RAY DIFFRACTION99.4208
2.779-2.9710.234810.1911701X-RAY DIFFRACTION98.7258
2.971-3.2090.263730.2021602X-RAY DIFFRACTION98.9953
3.209-3.5150.226790.2041456X-RAY DIFFRACTION98.3344
3.515-3.9290.248810.1831317X-RAY DIFFRACTION98.0365
3.929-4.5350.178720.1551167X-RAY DIFFRACTION98.4897
4.535-5.5510.177500.1521009X-RAY DIFFRACTION99.1573
5.551-7.8340.201310.185797X-RAY DIFFRACTION98.4542
7.834-55.050.202260.177456X-RAY DIFFRACTION97.7688

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more