[English] 日本語
Yorodumi
- PDB-6koc: X-ray Structure of the proton-pumping cytochrome aa3-600 menaquin... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 6koc
TitleX-ray Structure of the proton-pumping cytochrome aa3-600 menaquinol oxidase from Bacillus subtilis complexed with 3-iodo-N-oxo-2-heptyl-4-hydroxyquinoline
Components
  • (AA3-600 quinol oxidase subunit ...) x 2
  • (Quinol oxidase subunit ...) x 2
KeywordsOXIDOREDUCTASE / Menaquinol oxidase / Complex / Proton pumping / inhibitor
Function / homology
Function and homology information


Oxidoreductases; Acting on diphenols and related substances as donors; With oxygen as acceptor / cytochrome o ubiquinol oxidase complex / cytochrome bo3 ubiquinol oxidase activity / aerobic electron transport chain / respiratory chain complex / oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor / oxidative phosphorylation / cytochrome-c oxidase activity / proton transmembrane transporter activity / electron transport coupled proton transport ...Oxidoreductases; Acting on diphenols and related substances as donors; With oxygen as acceptor / cytochrome o ubiquinol oxidase complex / cytochrome bo3 ubiquinol oxidase activity / aerobic electron transport chain / respiratory chain complex / oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor / oxidative phosphorylation / cytochrome-c oxidase activity / proton transmembrane transporter activity / electron transport coupled proton transport / ATP synthesis coupled electron transport / aerobic respiration / respiratory electron transport chain / oxidoreductase activity / membrane raft / copper ion binding / heme binding / plasma membrane
Similarity search - Function
Quinol oxidase subunit II / Quinol oxidase subunit I / Quinol oxidase subunit III / Quinol oxidase subunit IV / : / Ubiquinol oxidase subunit III domain / Cytochrome C oxidase subunit IV, prokaryotes / Prokaryotic Cytochrome C oxidase subunit IV / Cytochrome o ubiquinol oxidase subunit II / Ubiquinol oxidase subunit 2, cupredoxin domain ...Quinol oxidase subunit II / Quinol oxidase subunit I / Quinol oxidase subunit III / Quinol oxidase subunit IV / : / Ubiquinol oxidase subunit III domain / Cytochrome C oxidase subunit IV, prokaryotes / Prokaryotic Cytochrome C oxidase subunit IV / Cytochrome o ubiquinol oxidase subunit II / Ubiquinol oxidase subunit 2, cupredoxin domain / Cytochrome c oxidase, subunit III, four-helix bundle / Cytochrome C Oxidase; Chain A / Cytochrome c oxidase-like, subunit I domain / Cytochrome C oxidase subunit II, transmembrane domain / Cytochrome C oxidase subunit II, transmembrane domain / Cytochrome oxidase subunit II transmembrane region profile. / Cytochrome c oxidase subunit III / Cytochrome c oxidase subunit III-like / Cytochrome c oxidase, subunit III, 4-helical bundle / Cytochrome c oxidase subunit III / Heme-copper oxidase subunit III family profile. / Cytochrome c oxidase subunit III-like superfamily / Cytochrome c/quinol oxidase subunit II / Cytochrome C oxidase subunit II, transmembrane domain superfamily / Cytochrome c oxidase, subunit I, copper-binding site / Heme-copper oxidase catalytic subunit, copper B binding region signature. / Cytochrome c oxidase-like, subunit I domain / Cytochrome oxidase subunit I profile. / Cytochrome C oxidase subunit II, periplasmic domain / Cytochrome c oxidase subunit II-like C-terminal / Cytochrome oxidase subunit II copper A binding domain profile. / Cytochrome c oxidase subunit I / Cytochrome c oxidase-like, subunit I superfamily / Cytochrome C and Quinol oxidase polypeptide I / Cupredoxins - blue copper proteins / Cupredoxin / Four Helix Bundle (Hemerythrin (Met), subunit A) / Prokaryotic membrane lipoprotein lipid attachment site profile. / Up-down Bundle / Immunoglobulin-like / Sandwich / Mainly Beta / Mainly Alpha
Similarity search - Domain/homology
COPPER (II) ION / HEME-A / 2-heptyl-3-iodanyl-1-oxidanyl-quinolin-4-one / Quinol oxidase subunit 3 / Quinol oxidase subunit 1 / Quinol oxidase subunit 2 / Quinol oxidase subunit 1 / Quinol oxidase subunit 2 / Quinol oxidase subunit 3 / Quinol oxidase subunit 4
Similarity search - Component
Biological speciesBacillus subtilis (bacteria)
Bacillus subtilis subsp. subtilis str. 168 (bacteria)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 3.8 Å
AuthorsXu, J. / Ding, Z. / Liu, B. / Li, J. / Gennis, R.B. / Zhu, J.
CitationJournal: Proc.Natl.Acad.Sci.USA / Year: 2020
Title: Structure of the cytochromeaa3-600 heme-copper menaquinol oxidase bound to inhibitor HQNO shows TM0 is part of the quinol binding site.
Authors: Xu, J. / Ding, Z. / Liu, B. / Yi, S.M. / Li, J. / Zhang, Z. / Liu, Y. / Li, J. / Liu, L. / Zhou, A. / Gennis, R.B. / Zhu, J.
History
DepositionAug 9, 2019Deposition site: PDBJ / Processing site: PDBJ
Revision 1.0Jan 15, 2020Provider: repository / Type: Initial release
Revision 1.1Jan 22, 2020Group: Database references / Category: citation
Item: _citation.pdbx_database_id_PubMed / _citation.title / _citation.year
Revision 1.2Jan 29, 2020Group: Database references / Category: citation
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation.year
Revision 1.3Nov 22, 2023Group: Data collection / Database references / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model / pdbx_validate_chiral
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: AA3-600 quinol oxidase subunit I
B: Quinol oxidase subunit 2
C: AA3-600 quinol oxidase subunit IIII
D: Quinol oxidase subunit 4,Quinol oxidase subunit 4
G: AA3-600 quinol oxidase subunit IIII
H: Quinol oxidase subunit 4,Quinol oxidase subunit 4
F: Quinol oxidase subunit 2
E: AA3-600 quinol oxidase subunit I
hetero molecules


Theoretical massNumber of molelcules
Total (without water)289,29216
Polymers284,9838
Non-polymers4,3098
Water00
1
A: AA3-600 quinol oxidase subunit I
B: Quinol oxidase subunit 2
C: AA3-600 quinol oxidase subunit IIII
D: Quinol oxidase subunit 4,Quinol oxidase subunit 4
hetero molecules


Theoretical massNumber of molelcules
Total (without water)144,6468
Polymers142,4924
Non-polymers2,1544
Water0
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area17160 Å2
ΔGint-184 kcal/mol
Surface area45290 Å2
MethodPISA
2
G: AA3-600 quinol oxidase subunit IIII
H: Quinol oxidase subunit 4,Quinol oxidase subunit 4
F: Quinol oxidase subunit 2
E: AA3-600 quinol oxidase subunit I
hetero molecules


Theoretical massNumber of molelcules
Total (without water)144,6468
Polymers142,4924
Non-polymers2,1544
Water0
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area17180 Å2
ΔGint-198 kcal/mol
Surface area45000 Å2
MethodPISA
Unit cell
Length a, b, c (Å)113.930, 162.200, 151.320
Angle α, β, γ (deg.)90.000, 109.760, 90.000
Int Tables number4
Space group name H-MP1211
Space group name HallP2yb

-
Components

-
AA3-600 quinol oxidase subunit ... , 2 types, 4 molecules AECG

#1: Protein AA3-600 quinol oxidase subunit I / Cytochrome aa3 quinol oxidase subunit I / Cytochrome aa3-600 quinol oxidase subunit I


Mass: 73892.789 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Bacillus subtilis (bacteria)
Gene: qoxB, B4122_4931, B4417_2140, ETA10_20065, ETK61_21170, ETL41_11350, SC09_contig4orf01211
Production host: Bacillus subtilis (bacteria) / References: UniProt: A0A063X8D0, UniProt: P34956*PLUS
#3: Protein AA3-600 quinol oxidase subunit IIII / cytochrome aa3-600 menaquinol oxidase / Cytochrome aa3-600 quinol oxidase subunit III / Quinol ...cytochrome aa3-600 menaquinol oxidase / Cytochrome aa3-600 quinol oxidase subunit III / Quinol oxidase subunit 3


Mass: 22689.572 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Bacillus subtilis (bacteria)
Gene: B4122_4930, B4417_2139, ETA10_20060, ETK61_21165, ETL41_11345, SC09_contig4orf01209
Production host: Bacillus subtilis (bacteria) / References: UniProt: A0A063X6N5, UniProt: P34958*PLUS

-
Quinol oxidase subunit ... , 2 types, 4 molecules BFDH

#2: Protein Quinol oxidase subunit 2 / cytochrome aa3-600 menaquinol oxidase


Mass: 33589.961 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Bacillus subtilis (bacteria) / Gene: qoxA, ETA10_20070, ETK61_21175, ETL41_11355 / Production host: Bacillus subtilis (bacteria)
References: UniProt: A0A2I7T8S1, UniProt: P34957*PLUS, Oxidoreductases; Acting on diphenols and related substances as donors; With oxygen as acceptor
#4: Protein Quinol oxidase subunit 4,Quinol oxidase subunit 4 / Quinol oxidase aa3-600 / subunit QoxD / Quinol oxidase polypeptide IV


Mass: 12319.210 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Bacillus subtilis subsp. subtilis str. 168 (bacteria), (gene. exp.) Bacillus subtilis (strain 168) (bacteria)
Strain: 168 / Gene: qoxD, BSU38140, ipa-40d / Production host: Bacillus subtilis (bacteria)
References: UniProt: P34959, Oxidoreductases; Acting on diphenols and related substances as donors; With oxygen as acceptor

-
Non-polymers , 3 types, 8 molecules

#5: Chemical
ChemComp-HEA / HEME-A


Mass: 852.837 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: C49H56FeN4O6
#6: Chemical ChemComp-CU / COPPER (II) ION


Mass: 63.546 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: Cu
#7: Chemical ChemComp-IHQ / 2-heptyl-3-iodanyl-1-oxidanyl-quinolin-4-one


Mass: 385.240 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: C16H20INO2

-
Details

Has ligand of interestN
Sequence detailsAuthors know the sequence of chain D/H, but they are not sure of the alignment for first 22 ...Authors know the sequence of chain D/H, but they are not sure of the alignment for first 22 residues in the coordinates. The residue numbers 0-21 in the coordinates may be meaningless. The correct sequence is ANKSAEHSHFPWKHIVGFILSIVLTLLALWVAVYTDLSSSAKLWII (UNP P34959)

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 4.62 Å3/Da / Density % sol: 76.6 %
Crystal growTemperature: 295 K / Method: vapor diffusion, sitting drop / pH: 6.3
Details: 0.1 M Calcium chloride, 0.1M Tris pH 6.3, 13% PEG 2000 MME

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: SSRF / Beamline: BL17U1 / Wavelength: 0.9793 Å
DetectorType: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Nov 26, 2018
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.9793 Å / Relative weight: 1
ReflectionResolution: 3.8→48.28 Å / Num. obs: 50255 / % possible obs: 98.5 % / Redundancy: 2.6 % / CC1/2: 0.878 / Rmerge(I) obs: 0.22 / Net I/σ(I): 3.4
Reflection shellResolution: 3.8→3.92 Å / Rmerge(I) obs: 1.264 / Num. unique obs: 4597 / CC1/2: 0.382

-
Processing

Software
NameVersionClassification
Aimlessdata scaling
PHENIX1.14_3235refinement
PDB_EXTRACT3.25data extraction
iMOSFLMdata reduction
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 6KOB
Resolution: 3.8→48.27 Å / Cross valid method: FREE R-VALUE
RfactorNum. reflection% reflection
Rfree0.3691 2011 -
Rwork0.3254 --
obs-48159 98.3785 %
Refinement stepCycle: LAST / Resolution: 3.8→48.27 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms17642 0 270 0 17912
LS refinement shellResolution: 3.8001→3.8951 Å
RfactorNum. reflection% reflection
Rfree0.401 --
Rwork0.3855 --
obs-3549 97.5 %
Refinement TLS params.Method: refined / Origin x: -24.7077 Å / Origin y: 5.1896 Å / Origin z: -12.9278 Å
111213212223313233
T0.6774 Å20.1906 Å20.2448 Å2-0.1263 Å2-0.2241 Å2--0.361 Å2
L1.5186 °2-0.0248 °21.9109 °2-0.9274 °2-0.3283 °2--4.7051 °2
S-0.1224 Å °0.0308 Å °0.018 Å °0.2075 Å °-0.0772 Å °0.0082 Å °-0.3988 Å °-0.0533 Å °0.1531 Å °
Refinement TLS groupSelection details: all

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more