F-box/LRR-repeatMAX2homolog / F-box and leucine-rich repeat MAX2 homolog / Protein DWARF 3
Mass: 75828.922 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Oryza sativa subsp. japonica (Japanese rice) Gene: D3, Os06g0154200, LOC_Os06g06050, OSJNBa0085L11.6-1 / Production host: Baculovirus expression vector pFastBac1-HM / References: UniProt: Q5VMP0
#2: Protein
SKP1-likeprotein1A / SKP1-like 1 / UFO-binding protein 1
Mass: 17876.043 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Arabidopsis thaliana (thale cress) / Gene: SKP1A, ASK1, SKP1, UIP1, At1g75950, T4O12.17 / Production host: Baculovirus expression vector pFastBac1-HM / References: UniProt: Q39255
Sequence details
TEV cleavage sequence (ENLYFQS) was introduced to replace the following: ...TEV cleavage sequence (ENLYFQS) was introduced to replace the following: EQPCSVANGTTTECDPEDDELGEVYESAAKKCRYMEFDD
-
Experimental details
-
Experiment
Experiment
Method: X-RAY DIFFRACTION / Number of used crystals: 1
-
Sample preparation
Crystal
Density Matthews: 2.16 Å3/Da / Density % sol: 43.06 %
Crystal grow
Temperature: 298 K / Method: vapor diffusion, hanging drop Details: 150 mM Tris-HCL, pH 7.4, 22% MPD, 22% PEG1000, 22% P3350, 15 mM Sodium Citrate tribasic dihydrate pH 5.6, 0.45 M 1,6-Hexanediol, 5 mM DTT
-
Data collection
Diffraction
Mean temperature: 298 K
Diffraction source
Source: SYNCHROTRON / Site: ALS / Beamline: 8.2.1 / Wavelength: 1 Å
In the structure databanks used in Yorodumi, some data are registered as the other names, "COVID-19 virus" and "2019-nCoV". Here are the details of the virus and the list of structure data.
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)
EMDB accession codes are about to change! (news from PDBe EMDB page)
The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
The EM Navigator/Yorodumi systems omit the EMD- prefix.
Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator
Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.
Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi