SEQUENCE 22 residues of the N-terminal domain of the protein (residues 1-122) have been modeled as ...SEQUENCE 22 residues of the N-terminal domain of the protein (residues 1-122) have been modeled as a poly-alanine sequence (the density in this domain is not good enough to allow sequence assignment). The residue numbers of the alanines in this region do not match residue numbers in the terminal protein sequence. These 22 residues have been noted as UNK for unkown residues. The actual sequence for first 122 residues is SGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANKSA GGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGGQ SFFSRKDSIRTIYTSLHNELKKVVAGRGAPGGTAPHVEELL
Mass: 18.015 Da / Num. of mol.: 25 / Source method: isolated from a natural source / Formula: H2O
Has protein modification
Y
-
Experimental details
-
Experiment
Experiment
Method: X-RAY DIFFRACTION / Number of used crystals: 1
-
Sample preparation
Crystal
Density Matthews: 2.72 Å3/Da / Density % sol: 54.81 %
Crystal grow
Temperature: 293 K / Method: vapor diffusion, hanging drop Details: PROTEIN SOLUTION (10 MG/ML PROTEIN, 0.050 M SODIUM CHLORIDE, 0.003 M SODIUM AZIDE, 0.0003 M TCEP, 0.005 MES PH 8.0) MIXED IN A 1:1 RATIO WITH THE WELL SOLUTION (0.003 SODIUM CHLORIDE, 0.10 M ...Details: PROTEIN SOLUTION (10 MG/ML PROTEIN, 0.050 M SODIUM CHLORIDE, 0.003 M SODIUM AZIDE, 0.0003 M TCEP, 0.005 MES PH 8.0) MIXED IN A 1:1 RATIO WITH THE WELL SOLUTION (0.003 SODIUM CHLORIDE, 0.10 M HEPES PH 7.5) Crystals cryo-protected with Fomblin followed by Paratone N, vapor diffusion, hanging drop, temperature 293K