[English] 日本語
Yorodumi- PDB-1u5b: Crystal structure of the human mitochondrial branched-chain alpha... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 1u5b | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Title | Crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase | |||||||||
Components | (2-oxoisovalerate dehydrogenase ...) x 2 | |||||||||
Keywords | OXIDOREDUCTASE / KETOACID DEHYDROGENASE / BRANCHED-CHAIN / MULTI-ENZYME COMPLEX / ACYLATION / OXIDATIVE DECARBOXYLATION MAPLE SYRUP URINE DISEASE / THIAMIN DIPHOSPHATE / PHOSPHORYLATION / FLAVOPROTEIN | |||||||||
| Function / homology | Function and homology informationLoss-of-function mutations in BCKDHA or BCKDHB cause MSUD / 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) / branched-chain 2-oxo acid dehydrogenase activity / branched-chain alpha-ketoacid dehydrogenase complex / BCKDH synthesizes BCAA-CoA from KIC, KMVA, KIV / Loss-of-function mutations in DBT cause MSUD2 / Loss-of-function mutations in DLD cause MSUD3/DLDD / H139Hfs13* PPM1K causes a mild variant of MSUD / Branched-chain ketoacid dehydrogenase kinase deficiency / branched-chain amino acid catabolic process ...Loss-of-function mutations in BCKDHA or BCKDHB cause MSUD / 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) / branched-chain 2-oxo acid dehydrogenase activity / branched-chain alpha-ketoacid dehydrogenase complex / BCKDH synthesizes BCAA-CoA from KIC, KMVA, KIV / Loss-of-function mutations in DBT cause MSUD2 / Loss-of-function mutations in DLD cause MSUD3/DLDD / H139Hfs13* PPM1K causes a mild variant of MSUD / Branched-chain ketoacid dehydrogenase kinase deficiency / branched-chain amino acid catabolic process / Branched-chain amino acid catabolism / carboxy-lyase activity / response to nutrient / lipid metabolic process / mitochondrial matrix / nucleolus / mitochondrion / nucleoplasm / metal ion binding Similarity search - Function | |||||||||
| Biological species | Homo sapiens (human) | |||||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.83 Å | |||||||||
Authors | Wynn, R.M. / Kato, M. / Machius, M. / Chuang, J.L. / Li, J. / Tomchick, D.R. / Chuang, D.T. | |||||||||
Citation | Journal: Structure / Year: 2004Title: Molecular mechanism for regulation of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase complex by phosphorylation Authors: Wynn, R.M. / Kato, M. / Machius, M. / Chuang, J.L. / Li, J. / Tomchick, D.R. / Chuang, D.T. #1: Journal: J.Biol.Chem. / Year: 2004Title: Crosstalk between thiamin diphosphate binding and phosphorylation loop conformation in human branched-chain A-ketoacid decarboxylase/dehydrogenase Authors: Li, J. / Wynn, R.M. / Machius, M. / Chuang, J.L. / KARTHIKEYAN, S. / Tomchick, D.R. / Chuang, D.T. #2: Journal: J.Biol.Chem. / Year: 2003Title: Roles of His291-alpha and His146-beta in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase: refined phosphorylation loop structure in the active site Authors: Wynn, R.M. / Machius, M. / Chuang, J.L. / Li, J. / Tomchick, D.R. / Chuang, D.T. | |||||||||
| History |
| |||||||||
| Remark 400 | SBD MOLECULE DETAILS MOLECULE: DIHYDROLIPOYLLYSINE-RESIDUE (2-METHYLPROPANOYL) TRANSFERASE; ...SBD MOLECULE DETAILS MOLECULE: DIHYDROLIPOYLLYSINE-RESIDUE (2-METHYLPROPANOYL) TRANSFERASE; FRAGMENT: SUBUNIT-BINDING DOMAIN; EC: 2.3.1.168; GENE: BCATE2; THE SBD MOLECULE WAS CREATED FROM A GENETICALLY MODIFIED SOURCE CONSISTENT WITH THE THE SOURCE RECORDS OF THE ALPHA AND BETA SUBUNITS OF 2-OXOISOVALERATE DEHYDROGENASE FOUND IN THIS STRUCTURE. SEQUENCE: GEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTLEHHHHHH 1 58 RESIDUES 2-50 CORRESPOND TO RESIDUES 165-213 OF SWISSPROT ENTRY ODB2_HUMAN, ACCESSION NUMBER P11182. THE FIRST GLYCINE RESIDUE IS A CLONING ARTIFACT. THE LAST 8 C-TERMINAL RESIDUES (LEHHHHHH) ARE HIS TAG RESIDUES. | |||||||||
| Remark 999 | SEQUENCE The subunit-binding domain (SBD) of the E2 protein binds to the C-terminal region of the ...SEQUENCE The subunit-binding domain (SBD) of the E2 protein binds to the C-terminal region of the E1 beta subunit. However, the electron density of this domain is too weak to build a model, therefore this molecule has not been modeled in the coordinates. Further information on this molecule can be found in Remark 400. |
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 1u5b.cif.gz | 174.2 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb1u5b.ent.gz | 133.7 KB | Display | PDB format |
| PDBx/mmJSON format | 1u5b.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Summary document | 1u5b_validation.pdf.gz | 776.7 KB | Display | wwPDB validaton report |
|---|---|---|---|---|
| Full document | 1u5b_full_validation.pdf.gz | 783.8 KB | Display | |
| Data in XML | 1u5b_validation.xml.gz | 32.3 KB | Display | |
| Data in CIF | 1u5b_validation.cif.gz | 48.5 KB | Display | |
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/u5/1u5b ftp://data.pdbj.org/pub/pdb/validation_reports/u5/1u5b | HTTPS FTP |
-Related structure data
| Related structure data | ![]() 1x7wC ![]() 1x7xC ![]() 1x7yC ![]() 1x7zC ![]() 1x80C ![]() 1olsS S: Starting model for refinement C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||
|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||
| Unit cell |
| ||||||||
| Components on special symmetry positions |
| ||||||||
| Details | The biological assembly is a heterotetramer generated from the heterodimer in the asymmetric unit by the operations: x, -y, 2/3-z. |
-
Components
-2-oxoisovalerate dehydrogenase ... , 2 types, 2 molecules AB
| #1: Protein | Mass: 45571.098 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: BCKDHA / Plasmid: PTRCHISB / Species (production host): Escherichia coli / Production host: ![]() References: UniProt: P12694, 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) |
|---|---|
| #2: Protein | Mass: 37902.270 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Gene: BCKDHB / Plasmid: PTRCHISB / Species (production host): Escherichia coli / Production host: ![]() References: UniProt: P21953, 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) |
-Non-polymers , 5 types, 484 molecules 








| #3: Chemical | | #4: Chemical | ChemComp-MN / | #5: Chemical | ChemComp-TPP / | #6: Chemical | ChemComp-GOL / | #7: Water | ChemComp-HOH / | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 2.5 Å3/Da / Density % sol: 50 % |
|---|---|
| Crystal grow | Temperature: 293 K / Method: vapor diffusion, hanging drop / pH: 5.8 Details: PEG4000, pH 5.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K |
-Data collection
| Diffraction | Mean temperature: 100 K | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: APS / Beamline: 19-ID / Wavelength: 1.5418 / Wavelength: 0.979 Å | |||||||||
| Detector | Type: ADSC QUANTUM 315 / Detector: CCD / Date: Oct 23, 2002 | |||||||||
| Radiation | Monochromator: Si(111) / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray | |||||||||
| Radiation wavelength |
| |||||||||
| Reflection | Resolution: 1.83→50 Å / Num. all: 71894 / Num. obs: 71894 / % possible obs: 99.7 % / Observed criterion σ(F): 0 / Observed criterion σ(I): -3 / Rmerge(I) obs: 0.106 / Net I/σ(I): 16.9 | |||||||||
| Reflection shell | Resolution: 1.83→1.86 Å / Rmerge(I) obs: 0.889 / % possible all: 100 |
-
Processing
| Software |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 1OLS Resolution: 1.83→50 Å / Cor.coef. Fo:Fc: 0.969 / Cor.coef. Fo:Fc free: 0.954 / SU B: 4.868 / SU ML: 0.077 / Cross valid method: THROUGHOUT / σ(F): 1 / ESU R: 0.109 / ESU R Free: 0.108 / Stereochemistry target values: MAXIMUM LIKELIHOOD
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 24.995 Å2
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 1.83→50 Å
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell | Resolution: 1.831→1.879 Å / Total num. of bins used: 20
|
Movie
Controller
About Yorodumi



Homo sapiens (human)
X-RAY DIFFRACTION
Citation















PDBj






