+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9ob1 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | S.c INO80 in complex with Yeast 0/80 nucleosome, Apo State | ||||||||||||||||||||||||
Components |
| ||||||||||||||||||||||||
Keywords | DNA BINDING PROTEIN/DNA / Chromatin Remodeler / nucleosome / DNA BINDING PROTEIN / DNA BINDING PROTEIN-DNA complex | ||||||||||||||||||||||||
| Function / homology | Function and homology informationsexual sporulation resulting in formation of a cellular spore / cupric reductase (NADH) activity / TTT Hsp90 cochaperone complex / HATs acetylate histones / global genome nucleotide-excision repair / RNA polymerase I upstream activating factor complex / Condensation of Prophase Chromosomes / : / : / Assembly of the ORC complex at the origin of replication ...sexual sporulation resulting in formation of a cellular spore / cupric reductase (NADH) activity / TTT Hsp90 cochaperone complex / HATs acetylate histones / global genome nucleotide-excision repair / RNA polymerase I upstream activating factor complex / Condensation of Prophase Chromosomes / : / : / Assembly of the ORC complex at the origin of replication / R2TP complex / HDACs deacetylate histones / regulation of TOR signaling / Swr1 complex / Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks / Oxidative Stress Induced Senescence / Ino80 complex / telomere maintenance via recombination / RMTs methylate histone arginines / ATP-dependent chromatin remodeler activity / regulation of metabolic process / DNA damage tolerance / box C/D snoRNP assembly / cellular response to stress / 3'-5' DNA helicase activity / RNA Polymerase I Promoter Escape / positive regulation of transcription by RNA polymerase I / NuA4 histone acetyltransferase complex / nucleolar large rRNA transcription by RNA polymerase I / Estrogen-dependent gene expression / rRNA transcription / intracellular copper ion homeostasis / chromosome, centromeric region / Ub-specific processing proteases / subtelomeric heterochromatin formation / enzyme regulator activity / CENP-A containing nucleosome / DNA helicase activity / aerobic respiration / Hydrolases; Acting on acid anhydrides; Acting on acid anhydrides to facilitate cellular and subcellular movement / rRNA processing / structural constituent of chromatin / heterochromatin formation / nucleosome / chromatin organization / histone binding / 5'-3' DNA helicase activity / transcription by RNA polymerase II / DNA helicase / chromosome, telomeric region / protein stabilization / chromatin remodeling / protein heterodimerization activity / DNA repair / regulation of transcription by RNA polymerase II / regulation of DNA-templated transcription / chromatin / negative regulation of transcription by RNA polymerase II / positive regulation of transcription by RNA polymerase II / ATP hydrolysis activity / DNA binding / ATP binding / nucleus / cytoplasm Similarity search - Function | ||||||||||||||||||||||||
| Biological species | ![]() synthetic construct (others) | ||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.2 Å | ||||||||||||||||||||||||
Authors | Wu, H. / Kaur, U. / Narlikar, G.J. / Cheng, Y.F. | ||||||||||||||||||||||||
| Funding support | United States, 1items
| ||||||||||||||||||||||||
Citation | Journal: Science / Year: 2025Title: Autoinhibition imposed by a large conformational switch of INO80 regulates nucleosome positioning. Authors: Upneet Kaur / Hao Wu / Yifan Cheng / Geeta J Narlikar / ![]() Abstract: Increasing the flanking DNA from 40 to 80 base pairs (bp) causes ~100-fold faster nucleosome sliding by INO80. A prevalent hypothesis posits that the Arp8 module within INO80 enables a ruler-like ...Increasing the flanking DNA from 40 to 80 base pairs (bp) causes ~100-fold faster nucleosome sliding by INO80. A prevalent hypothesis posits that the Arp8 module within INO80 enables a ruler-like activity. Using cryogenic electron microscopy, we show that on nucleosomes with 40 bp of flanking DNA, the Arp8 module rotates 180° away from the DNA. Deleting the Arp8 module enables rapid sliding irrespective of flanking DNA length. Thus, rather than enabling a ruler-like activity, the Arp8 module acts as a brake on INO80 remodeling when flanking DNA is short. This autoinhibition-based mechanism has broad implications for understanding how primitive nucleosome mobilization enzymes may have evolved into sophisticated remodelers. | ||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9ob1.cif.gz | 1 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9ob1.ent.gz | Display | PDB format | |
| PDBx/mmJSON format | 9ob1.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/ob/9ob1 ftp://data.pdbj.org/pub/pdb/validation_reports/ob/9ob1 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 70289MC ![]() 9c9gC ![]() 9c9sC ![]() 9c9tC ![]() 9c9xC ![]() 9c9zC ![]() 9canC ![]() 9catC ![]() 9cauC ![]() 9cb7C ![]() 9ccdC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-DNA chain , 2 types, 2 molecules IJ
| #1: DNA chain | Mass: 69840.398 Da / Num. of mol.: 1 / Source method: obtained synthetically / Source: (synth.) synthetic construct (others) |
|---|---|
| #2: DNA chain | Mass: 70347.750 Da / Num. of mol.: 1 / Source method: obtained synthetically / Source: (synth.) synthetic construct (others) |
-Chromatin-remodeling ... , 2 types, 2 molecules QS
| #3: Protein | Mass: 171693.812 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() References: UniProt: P53115, Hydrolases; Acting on acid anhydrides; Acting on acid anhydrides to facilitate cellular and subcellular movement |
|---|---|
| #5: Protein | Mass: 18564.965 Da / Num. of mol.: 1 / Source method: isolated from a natural source Details: MSGSRGNSSNSSVSNNSNNNNNNDGGDERLLFLRSVGERNEIGFPSRFKSAHYKKPTRRHKSARQLISDENKRINALLTK ANKAAESSTAARRLVPKATYFSVEAPPSIRPAKKYCDVTGLKGFYKSPTNNIRYHNAEIYQLIVKPMAPGVDQEYLKLRG ANFVLK Source: (natural) ![]() |
-Protein , 6 types, 10 molecules RZAEBFCGDH
| #4: Protein | Mass: 87682.359 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() | ||||||
|---|---|---|---|---|---|---|---|
| #8: Protein | Mass: 36210.953 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() | ||||||
| #9: Protein | Mass: 15391.007 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Gene: HHT1, YBR010W, YBR0201, HHT2, SIN2, YNL031C, N2749 / Production host: ![]() #10: Protein | Mass: 11394.426 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() #11: Protein | Mass: 14013.177 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10 / Production host: ![]() #12: Protein | Mass: 14280.362 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C / Production host: ![]() |
-RuvB-like protein ... , 2 types, 6 molecules TVXUWY
| #6: Protein | Mass: 50516.941 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) ![]() #7: Protein | Mass: 51673.488 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|
-Non-polymers , 1 types, 6 molecules 
| #13: Chemical | ChemComp-ADP / |
|---|
-Details
| Has ligand of interest | Y |
|---|---|
| Has protein modification | N |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: CELL / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: S.c INO80 in complex with Yeast 0/80 nucleosome, Apo State Type: COMPLEX / Entity ID: #1-#12 / Source: MULTIPLE SOURCES |
|---|---|
| Buffer solution | pH: 7.5 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Vitrification | Cryogen name: OTHER |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: TFS KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: SPOT SCAN |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2000 nm / Nominal defocus min: 1000 nm |
| Image recording | Electron dose: 47.7 e/Å2 / Film or detector model: GATAN K3 (6k x 4k) |
-
Processing
| EM software | Name: PHENIX / Version: 1.20.1_4487: / Category: model refinement | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 3.2 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 17836 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi






United States, 1items
Citation




















PDBj















































FIELD EMISSION GUN