[English] 日本語
Yorodumi
- PDB-9myv: Structure of human neuronal nitric oxide synthase R354A/G357D mut... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 9myv
TitleStructure of human neuronal nitric oxide synthase R354A/G357D mutant heme domain bound with 2-(2-amino-6-fluoro-4-methylquinolin-7-yl)-5-(aminomethyl)phenol
ComponentsNitric oxide synthase, brain
KeywordsOXIDOREDUCTASE / nitric oxide synthase inhibitor binding / OXIDOREDUCTASE-INHIBITOR complex
Function / homology
Function and homology information


positive regulation of membrane repolarization during ventricular cardiac muscle cell action potential / negative regulation of calcium ion transport into cytosol / myoblast fusion / Nitric oxide stimulates guanylate cyclase / ROS and RNS production in phagocytes / tetrahydrobiopterin binding / arginine binding / regulation of calcium ion transmembrane transport via high voltage-gated calcium channel / synaptic signaling by nitric oxide / regulation of cardiac muscle contraction by calcium ion signaling ...positive regulation of membrane repolarization during ventricular cardiac muscle cell action potential / negative regulation of calcium ion transport into cytosol / myoblast fusion / Nitric oxide stimulates guanylate cyclase / ROS and RNS production in phagocytes / tetrahydrobiopterin binding / arginine binding / regulation of calcium ion transmembrane transport via high voltage-gated calcium channel / synaptic signaling by nitric oxide / regulation of cardiac muscle contraction by calcium ion signaling / positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway / positive regulation of sodium ion transmembrane transport / peptidyl-cysteine S-nitrosylase activity / negative regulation of calcium ion transport / negative regulation of potassium ion transport / regulation of sodium ion transport / positive regulation of the force of heart contraction / cadmium ion binding / regulation of postsynaptic membrane potential / nitric-oxide synthase (NADPH) / multicellular organismal response to stress / regulation of neurogenesis / sodium channel regulator activity / : / nitric-oxide synthase activity / L-arginine catabolic process / xenobiotic catabolic process / negative regulation of serotonin uptake / regulation of cardiac muscle contraction / negative regulation of blood pressure / nitric oxide biosynthetic process / Ion homeostasis / response to hormone / photoreceptor inner segment / cell redox homeostasis / sarcoplasmic reticulum membrane / T-tubule / calyx of Held / cell periphery / sarcoplasmic reticulum / striated muscle contraction / calcium channel regulator activity / vasodilation / cellular response to growth factor stimulus / sarcolemma / caveola / Z disc / positive regulation of neuron apoptotic process / calcium-dependent protein binding / NADP binding / FMN binding / flavin adenine dinucleotide binding / response to heat / response to lipopolysaccharide / scaffold protein binding / response to hypoxia / dendritic spine / cytoskeleton / transmembrane transporter binding / calmodulin binding / postsynaptic density / membrane raft / heme binding / synapse / positive regulation of DNA-templated transcription / perinuclear region of cytoplasm / positive regulation of transcription by RNA polymerase II / protein-containing complex / mitochondrion / nucleus / plasma membrane / cytosol / cytoplasm
Similarity search - Function
Nitric-oxide synthase, eukaryote / Nitric oxide synthase, N-terminal / Nitric oxide synthase, N-terminal domain superfamily / Nitric oxide synthase, domain 2 superfamily / Nitric oxide synthase, domain 1 superfamily / Nitric oxide synthase, domain 3 superfamily / : / Nitric oxide synthase, oxygenase domain / Nitric oxide synthase (NOS) signature. / Sulfite reductase [NADPH] flavoprotein alpha-component-like, FAD-binding ...Nitric-oxide synthase, eukaryote / Nitric oxide synthase, N-terminal / Nitric oxide synthase, N-terminal domain superfamily / Nitric oxide synthase, domain 2 superfamily / Nitric oxide synthase, domain 1 superfamily / Nitric oxide synthase, domain 3 superfamily / : / Nitric oxide synthase, oxygenase domain / Nitric oxide synthase (NOS) signature. / Sulfite reductase [NADPH] flavoprotein alpha-component-like, FAD-binding / NADPH-cytochrome p450 reductase, FAD-binding, alpha-helical domain superfamily / FAD binding domain / Flavodoxin-like / Flavoprotein pyridine nucleotide cytochrome reductase / Flavodoxin / Flavodoxin-like domain profile. / Flavodoxin/nitric oxide synthase / Oxidoreductase FAD/NAD(P)-binding / Oxidoreductase NAD-binding domain / PDZ domain / FAD-binding domain, ferredoxin reductase-type / Ferredoxin-NADP reductase (FNR), nucleotide-binding domain / Ferredoxin reductase-type FAD binding domain profile. / Riboflavin synthase-like beta-barrel / Flavoprotein-like superfamily / PDZ domain profile. / Domain present in PSD-95, Dlg, and ZO-1/2. / PDZ domain / PDZ superfamily
Similarity search - Domain/homology
: / 5,6,7,8-TETRAHYDROBIOPTERIN / PROTOPORPHYRIN IX CONTAINING FE / Nitric oxide synthase 1
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / FOURIER SYNTHESIS / Resolution: 2.149 Å
AuthorsLi, H. / Poulos, T.L.
Funding support United States, 1items
OrganizationGrant numberCountry
National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)GM131920 United States
CitationJournal: J.Med.Chem. / Year: 2026
Title: Enhancement of Potency and Selectivity of 2-Aminoquinoline-Based Human Neuronal Nitric Oxide Synthase Inhibitors.
Authors: Ansari, A. / Kang, K.M. / Li, H. / Hardy, C.D. / Rathnayake, A.D. / Awasthi, A. / Poulos, T.L. / Silverman, R.B.
History
DepositionJan 22, 2025Deposition site: RCSB / Processing site: RCSB
Revision 1.0Dec 3, 2025Provider: repository / Type: Initial release
Revision 1.1Apr 1, 2026Group: Database references / Category: citation / citation_author
Item: _citation.country / _citation.journal_abbrev ..._citation.country / _citation.journal_abbrev / _citation.journal_id_ASTM / _citation.journal_id_CSD / _citation.journal_id_ISSN / _citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_DOI / _citation.pdbx_database_id_PubMed / _citation.title / _citation.year
Revision 1.2Aug 12, 2026Group: Derived calculations / Structure summary
Category: pdbx_entry_details / pdbx_modification_feature ...pdbx_entry_details / pdbx_modification_feature / pdbx_nonpoly_atom_coordination / pdbx_nonpoly_atom_coordination_sphere / pdbx_nonpoly_atom_coordination_sphere_order
Item: _pdbx_entry_details.has_protein_modification / Description: Metalloprotein remediation / Provider: repository / Type: Remediation

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Nitric oxide synthase, brain
B: Nitric oxide synthase, brain
C: Nitric oxide synthase, brain
D: Nitric oxide synthase, brain
hetero molecules


Theoretical massNumber of molelcules
Total (without water)201,29124
Polymers195,9874
Non-polymers5,30420
Water11,440635
1
A: Nitric oxide synthase, brain
B: Nitric oxide synthase, brain
hetero molecules


Theoretical massNumber of molelcules
Total (without water)100,64512
Polymers97,9942
Non-polymers2,65210
Water362
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area9960 Å2
ΔGint-81 kcal/mol
Surface area33940 Å2
MethodPISA
2
C: Nitric oxide synthase, brain
D: Nitric oxide synthase, brain
hetero molecules


Theoretical massNumber of molelcules
Total (without water)100,64512
Polymers97,9942
Non-polymers2,65210
Water362
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area9830 Å2
ΔGint-82 kcal/mol
Surface area34340 Å2
MethodPISA
Unit cell
Length a, b, c (Å)118.881, 52.226, 164.574
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number4
Space group name H-MP1211

-
Components

-
Protein , 1 types, 4 molecules ABCD

#1: Protein
Nitric oxide synthase, brain / Constitutive NOS / NC-NOS / NOS type I / Neuronal NOS / nNOS / Peptidyl-cysteine S-nitrosylase NOS1 / bNOS


Mass: 48996.781 Da / Num. of mol.: 4
Mutation: R354A, G357DCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVATKDQLFPLAKEFIDQYYSSIKRFGSKA HMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLR ...Mutation: R354A, G357DCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVATKDQLFPLAKEFIDQYYSSIKRFGSKA HMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLR SAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQI PPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNL DMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEML NYRLTPSFEYQPDPWNTHVWKLV
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: NOS1 / Organ: brain / Plasmid: pET22b / Production host: Escherichia coli BL21(DE3) (bacteria) / References: UniProt: P29475, nitric-oxide synthase (NADPH)

-
Non-polymers , 6 types, 655 molecules

#2: Chemical
ChemComp-HEM / PROTOPORPHYRIN IX CONTAINING FE / HEME


Mass: 616.487 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: C34H32FeN4O4
#3: Chemical
ChemComp-H4B / 5,6,7,8-TETRAHYDROBIOPTERIN


Mass: 241.247 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: C9H15N5O3 / Comment: neurotransmitter*YM
#4: Chemical
ChemComp-A1BUF / (2M)-2-(2-amino-6-fluoro-4-methylquinolin-7-yl)-5-(aminomethyl)phenol


Mass: 297.327 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: C17H16FN3O / Feature type: SUBJECT OF INVESTIGATION
#5: Chemical
ChemComp-GOL / GLYCEROL / GLYCERIN / PROPANE-1,2,3-TRIOL


Mass: 92.094 Da / Num. of mol.: 6 / Source method: obtained synthetically / Formula: C3H8O3
#6: Chemical ChemComp-ZN / ZINC ION


Mass: 65.409 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: Zn
#7: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 635 / Source method: isolated from a natural source / Formula: H2O

-
Details

Has ligand of interestY
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.74 Å3/Da / Density % sol: 55.2 % / Description: plates
Crystal growTemperature: 277 K / Method: vapor diffusion, sitting drop / pH: 7.2
Details: 8% PEG3350 35mM citric acid 65mM Bis-Tris-Propane 10% glycerol 5mM TCEP

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: SSRL / Beamline: BL12-2 / Wavelength: 0.97947 Å
DetectorType: DECTRIS PILATUS 6M / Detector: PIXEL / Date: May 15, 2024 / Details: mirrors
RadiationMonochromator: DOUBLE CRYSTAL SI(III) / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.97947 Å / Relative weight: 1
ReflectionResolution: 2.149→39.63 Å / Num. obs: 110978 / % possible obs: 99.9 % / Redundancy: 7.7 % / CC1/2: 0.998 / Rmerge(I) obs: 0.129 / Rpim(I) all: 0.049 / Rrim(I) all: 0.138 / Net I/σ(I): 8.7
Reflection shellResolution: 2.15→2.19 Å / Redundancy: 7.8 % / Rmerge(I) obs: 2.372 / Num. unique obs: 5487 / CC1/2: 0.491 / Rpim(I) all: 0.899 / Rrim(I) all: 2.541 / % possible all: 99.4

-
Processing

Software
NameVersionClassification
PHENIX(1.11.1_2575: ???)refinement
Aimlessdata scaling
XDSdata reduction
REFMACphasing
RefinementMethod to determine structure: FOURIER SYNTHESIS / Resolution: 2.149→39.233 Å / SU ML: 0.31 / Cross valid method: FREE R-VALUE / σ(F): 0 / Phase error: 28.71 / Stereochemistry target values: ML
RfactorNum. reflection% reflectionSelection details
Rfree0.2327 10772 5.01 %random
Rwork0.1797 ---
obs0.1824 110801 99.76 %-
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL
Refinement stepCycle: LAST / Resolution: 2.149→39.233 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms13548 0 365 635 14548
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.00714402
X-RAY DIFFRACTIONf_angle_d0.96419613
X-RAY DIFFRACTIONf_dihedral_angle_d18.1198399
X-RAY DIFFRACTIONf_chiral_restr0.0532020
X-RAY DIFFRACTIONf_plane_restr0.0062475
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
2.1494-2.17380.37273520.3186940X-RAY DIFFRACTION99
2.1738-2.19940.34743590.3026722X-RAY DIFFRACTION100
2.1994-2.22620.37363800.30276804X-RAY DIFFRACTION100
2.2262-2.25440.36333640.29766779X-RAY DIFFRACTION100
2.2544-2.2840.37993750.29396836X-RAY DIFFRACTION100
2.284-2.31530.34353280.27916753X-RAY DIFFRACTION100
2.3153-2.34840.33963480.27736802X-RAY DIFFRACTION100
2.3484-2.38340.34563720.26786881X-RAY DIFFRACTION100
2.3834-2.42070.31963900.26386670X-RAY DIFFRACTION100
2.4207-2.46030.30453280.25566815X-RAY DIFFRACTION100
2.4603-2.50280.27973720.24926865X-RAY DIFFRACTION100
2.5028-2.54830.28813760.23896696X-RAY DIFFRACTION100
2.5483-2.59730.25883720.21656940X-RAY DIFFRACTION100
2.5973-2.65030.30013890.21746754X-RAY DIFFRACTION100
2.6503-2.70790.28513740.22266755X-RAY DIFFRACTION100
2.7079-2.77090.30253440.22336874X-RAY DIFFRACTION100
2.7709-2.84010.29573080.20956777X-RAY DIFFRACTION100
2.8401-2.91690.27353370.2036896X-RAY DIFFRACTION100
2.9169-3.00270.26393750.20566761X-RAY DIFFRACTION100
3.0027-3.09960.27193270.21056894X-RAY DIFFRACTION100
3.0996-3.21030.2913570.19546799X-RAY DIFFRACTION100
3.2103-3.33880.22893550.17966833X-RAY DIFFRACTION100
3.3388-3.49070.2293770.17346840X-RAY DIFFRACTION100
3.4907-3.67460.21783340.15596811X-RAY DIFFRACTION99
3.6746-3.90460.18443880.1496701X-RAY DIFFRACTION100
3.9046-4.20570.18953570.13476862X-RAY DIFFRACTION100
4.2057-4.62840.16323140.13016879X-RAY DIFFRACTION100
4.6284-5.29670.17993920.12936801X-RAY DIFFRACTION100
5.2967-6.6680.18973700.15296788X-RAY DIFFRACTION100
6.668-39.2330.19053580.156787X-RAY DIFFRACTION99
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
10.9237-0.1711-0.00960.42770.15281.8382-0.0357-0.0821-0.04280.0150.03740.06650.104-0.015-0.0030.3348-0.00070.03920.26350.06130.3364-34.40617.8847-38.4819
20.8654-0.27090.00550.52740.02792.8394-0.05660.04290.08530.0450.0054-0.0272-0.09480.13770.05450.3392-0.0141-0.00550.26340.04810.3031-34.83159.7591-1.0696
30.90540.2461-0.09580.58040.01412.8493-0.0513-0.0685-0.0879-0.0452-0.0097-0.02090.08780.12320.05190.35060.0118-0.00510.280.04850.318324.544231.6557-81.185
40.99330.21360.04720.42160.18211.853-0.03920.07020.052-0.01380.02130.0582-0.12110.0060.01220.32560.0045-0.04150.26580.05990.339425.032433.5698-43.7721
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection details
1X-RAY DIFFRACTION1(chain A and resid 304:722)
2X-RAY DIFFRACTION2(chain B and resid 304:722)
3X-RAY DIFFRACTION3(chain C and resid 304:722)
4X-RAY DIFFRACTION4(chain D and resid 304:722)

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more