+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9jc1 | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Engineering of ATP synthase | |||||||||||||||||||||
Components | (ATP synthase ...) x 6 | |||||||||||||||||||||
Keywords | MEMBRANE PROTEIN / Molecular Motor / ATP synthase | |||||||||||||||||||||
| Function / homology | Function and homology informationproton motive force-driven plasma membrane ATP synthesis / H+-transporting two-sector ATPase / proton-transporting ATP synthase complex / proton-transporting ATP synthase activity, rotational mechanism / ADP binding / ATP binding / plasma membrane Similarity search - Function | |||||||||||||||||||||
| Biological species | ![]() | |||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 2.79 Å | |||||||||||||||||||||
Authors | Hamaguchi-Suzuki, N. / Ueno, H. / Yasuda, K. / Marui, R. / Adachi, N. / Senda, T. / Noji, H. / Murata, T. | |||||||||||||||||||||
| Funding support | Japan, France, 6items
| |||||||||||||||||||||
Citation | Journal: Nat Commun / Year: 2025Title: Engineering of ATP synthase for enhancement of proton-to-ATP ratio. Authors: Hiroshi Ueno / Kiyoto Yasuda / Norie Hamaguchi-Suzuki / Riku Marui / Naruhiko Adachi / Toshiya Senda / Takeshi Murata / Hiroyuki Noji / ![]() Abstract: FF-ATP synthase (FF) interconverts the energy of the proton motive force (pmf) and that of ATP through the mechanical rotation. The H/ATP ratio, one of the most crucial parameters in bioenergetics, ...FF-ATP synthase (FF) interconverts the energy of the proton motive force (pmf) and that of ATP through the mechanical rotation. The H/ATP ratio, one of the most crucial parameters in bioenergetics, varies among species due to differences in the number of H-binding c-subunits, resulting in H/ATP ratios ranging from 2.7 to 5. In this study, we seek to significantly enhance the H/ATP ratio by employing an alternative approach that differs from that of nature. We engineer FF to form multiple peripheral stalks, each bound to a proton-conducting a-subunit. The engineered FF exhibits an H/ATP ratio of 5.8, surpassing the highest ratios found in naturally occurring FFs, enabling ATP synthesis under low pmf conditions where wild-type enzymes cannot synthesize ATP. Structural analysis reveals that the engineered FF forms up to three peripheral stalks and a-subunits. This study not only provides valuable insights into the H-transport mechanism of FF but also opens up possibilities for engineering the foundation of cellular bioenergetics. | |||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9jc1.cif.gz | 876.4 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9jc1.ent.gz | 566.1 KB | Display | PDB format |
| PDBx/mmJSON format | 9jc1.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/jc/9jc1 ftp://data.pdbj.org/pub/pdb/validation_reports/jc/9jc1 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 61339MC ![]() 9jc2C M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-ATP synthase ... , 6 types, 14 molecules DEFGHIJKACMBLN
| #1: Protein | Mass: 53424.625 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() ![]() References: UniProt: A0A0M4U1P9, H+-transporting two-sector ATPase #2: Protein | | Mass: 31859.523 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() ![]() #3: Protein | | Mass: 9221.647 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() ![]() #4: Protein | Mass: 63248.145 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: based on pTR19-ASDS, which was created by Suzuki et al. (doi: 10.1074/jbc.M111210200),based on pTR19-ASDS, which was created by Suzuki et al. (doi: 10.1074/jbc.M111210200) Source: (gene. exp.) ![]() ![]() References: UniProt: A0A0M3VGF9, H+-transporting two-sector ATPase #5: Protein | Mass: 18601.707 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: the same molecule as chain B,L and N; the full sequence is MGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEA EKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKETAKKEIEREKE ...Details: the same molecule as chain B,L and N; the full sequence is MGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEA EKLLEEQRELMKQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKETAKKEIEREKE QAMAALREQVASLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEVGGAR Source: (gene. exp.) ![]() ![]() #6: Protein | Mass: 19437.396 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: based on pTR19-ASDS, which was created by Suzuki et al. (doi: 10.1074/jbc.M111210200) Source: (gene. exp.) ![]() ![]() |
|---|
-Non-polymers , 2 types, 5 molecules 


| #7: Chemical | ChemComp-ADP / |
|---|---|
| #8: Chemical | ChemComp-MG / |
-Details
| Has ligand of interest | N |
|---|---|
| Has protein modification | N |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Bacillus PS3 FoF1 / Type: COMPLEX / Entity ID: #1-#4, #6, #5 / Source: RECOMBINANT |
|---|---|
| Molecular weight | Experimental value: NO |
| Source (natural) | Organism: ![]() |
| Source (recombinant) | Organism: ![]() |
| Buffer solution | pH: 7.5 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Specimen support | Grid material: COPPER / Grid mesh size: 300 divisions/in. / Grid type: Quantifoil R1.2/1.3 |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: TFS KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2000 nm / Nominal defocus min: 800 nm |
| Image recording | Electron dose: 50 e/Å2 / Film or detector model: FEI FALCON IV (4k x 4k) / Num. of grids imaged: 3 / Num. of real images: 56081 |
-
Processing
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Symmetry | Point symmetry: C1 (asymmetric) | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 2.79 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 88259 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refinement | Cross valid method: NONE Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2 | ||||||||||||||||||||||||
| Displacement parameters | Biso mean: 74.93 Å2 | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi






Japan,
France, 6items
Citation
















PDBj




FIELD EMISSION GUN