[English] 日本語
Yorodumi
- PDB-9j11: Structure of mEos3.2 in the green fluorescent state -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 9j11
TitleStructure of mEos3.2 in the green fluorescent state
ComponentsGreen to red photoconvertible GFP-like protein EosFP
KeywordsFLUORESCENT PROTEIN / Green-to-red photoconvertible fluorescent protein
Function / homologyGreen fluorescent protein, GFP / Green fluorescent protein-related / Green fluorescent protein / Green fluorescent protein / bioluminescence / generation of precursor metabolites and energy / 2,3-DIHYDROXY-1,4-DITHIOBUTANE / Green to red photoconvertible GFP-like protein EosFP
Function and homology information
Biological speciesLobophyllia hemprichii (invertebrata)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.85 Å
AuthorsZheng, S.P. / Shi, X.R.
Funding support1items
OrganizationGrant numberCountry
Other government
CitationJournal: Acta Crystallogr D Struct Biol / Year: 2025
Title: Structural basis for the fast maturation of pcStar, a photoconvertible fluorescent protein.
Authors: Zheng, S. / Shi, X. / Lin, J. / Yang, Y. / Xin, Y. / Bai, X. / Zhu, H. / Chen, H. / Wu, J. / Zheng, X. / Lin, L. / Huang, Z. / Yang, S. / Hu, F. / Liu, W.
History
DepositionAug 3, 2024Deposition site: PDBJ / Processing site: PDBC
Revision 1.0Apr 16, 2025Provider: repository / Type: Initial release
Revision 2.0Mar 18, 2026Group: Polymer sequence / Category: entity_poly / Item: _entity_poly.pdbx_seq_one_letter_code_can

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Green to red photoconvertible GFP-like protein EosFP
B: Green to red photoconvertible GFP-like protein EosFP
hetero molecules


Theoretical massNumber of molelcules
Total (without water)57,2393
Polymers57,0842
Non-polymers1541
Water7,764431
1
A: Green to red photoconvertible GFP-like protein EosFP


Theoretical massNumber of molelcules
Total (without water)28,5421
Polymers28,5421
Non-polymers00
Water181
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
2
B: Green to red photoconvertible GFP-like protein EosFP
hetero molecules


Theoretical massNumber of molelcules
Total (without water)28,6962
Polymers28,5421
Non-polymers1541
Water181
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Unit cell
Length a, b, c (Å)51.357, 82.392, 61.775
Angle α, β, γ (deg.)90.00, 101.93, 90.00
Int Tables number4
Space group name H-MP1211

-
Components

#1: Protein Green to red photoconvertible GFP-like protein EosFP


Mass: 28542.238 Da / Num. of mol.: 2 / Mutation: N11K,E70K,H74N,I102N,H121Y,V123T,T158E,Y189A
Source method: isolated from a genetically manipulated source
Details: Fusion protein: ...Details: Fusion protein: MGSSHHHHHHSQDPLEVLFQGPEFMSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR
Source: (gene. exp.) Lobophyllia hemprichii (invertebrata) / Production host: Escherichia coli (E. coli) / References: UniProt: Q5S6Z9
#2: Chemical ChemComp-DTT / 2,3-DIHYDROXY-1,4-DITHIOBUTANE / 1,4-DITHIOTHREITOL


Mass: 154.251 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: C4H10O2S2
#3: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 431 / Source method: isolated from a natural source / Formula: H2O
Has ligand of interestY
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.24 Å3/Da / Density % sol: 45.09 %
Crystal growTemperature: 289 K / Method: vapor diffusion, sitting drop
Details: 0.2 M Ammonium acetate, 0.1 M Sodium acetate trihydrate, pH 6.0, 30% (w/v) PEG 4000

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: SSRF / Beamline: BL18U1 / Wavelength: 0.97853 Å
DetectorType: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Oct 4, 2023
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.97853 Å / Relative weight: 1
ReflectionResolution: 1.85→48.73 Å / Num. obs: 43073 / % possible obs: 100 % / Redundancy: 6.8 % / CC1/2: 0.999 / Net I/σ(I): 12.8
Reflection shellResolution: 1.85→1.95 Å / Num. unique obs: 6286 / CC1/2: 0.842

-
Processing

Software
NameVersionClassification
PHENIX(1.20.1_4487: ???)refinement
autoPROCdata reduction
autoPROCdata scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 5OOZ
Resolution: 1.85→28.64 Å / SU ML: 0.14 / Cross valid method: NONE / σ(F): 0.03 / Phase error: 17.84 / Stereochemistry target values: ML
RfactorNum. reflection% reflection
Rfree0.184 1903 4.64 %
Rwork0.1533 --
obs0.1548 41044 95.33 %
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.1 Å / Solvent model: FLAT BULK SOLVENT MODEL
Refinement stepCycle: LAST / Resolution: 1.85→28.64 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms3500 0 0 431 3931
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.0083611
X-RAY DIFFRACTIONf_angle_d1.4624867
X-RAY DIFFRACTIONf_dihedral_angle_d9.436483
X-RAY DIFFRACTIONf_chiral_restr0.064493
X-RAY DIFFRACTIONf_plane_restr0.009631
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
1.85-1.90.25021250.19762522X-RAY DIFFRACTION86
1.9-1.950.20441230.18952622X-RAY DIFFRACTION89
1.95-20.21311220.16952640X-RAY DIFFRACTION91
2-2.070.1911340.16362723X-RAY DIFFRACTION93
2.07-2.140.20261330.1612746X-RAY DIFFRACTION94
2.14-2.230.19981350.1512782X-RAY DIFFRACTION95
2.23-2.330.19881360.15962801X-RAY DIFFRACTION96
2.33-2.450.21131410.16232813X-RAY DIFFRACTION97
2.45-2.610.1831400.15672869X-RAY DIFFRACTION98
2.61-2.810.16051410.14812877X-RAY DIFFRACTION98
2.81-3.090.19391420.14762904X-RAY DIFFRACTION99
3.09-3.540.19231420.13952913X-RAY DIFFRACTION99
3.54-4.450.14531430.13412942X-RAY DIFFRACTION100
4.45-28.640.1811460.16352987X-RAY DIFFRACTION100
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
14.7984-0.45660.24042.03920.17471.94790.0088-0.5202-0.1780.22350.0272-0.0290.01890.0291-0.03670.1598-0.01-0.01010.14430.00280.12070.238122.3059-9.1096
24.18390.56860.39863.19460.482.8775-0.03760.0035-0.19710.0612-0.03290.31680.0805-0.33230.07320.1083-0.00650.01720.1509-0.01260.1582-13.953216.8056-17.3215
36.94573.3135-7.45182.1445-3.18318.2338-0.133-0.1445-0.5455-0.1262-0.0625-0.24360.27820.09540.33170.1640.0078-0.02320.1651-0.00320.19451.205714.3736-18.1693
45.24641.4646-5.96651.6835-1.31246.8477-0.2278-0.3816-0.58570.0770.0073-0.06460.35620.16570.20660.1618-0.0034-0.04360.2129-0.00310.1635-0.479314.9455-9.6558
53.25790.2304-0.31782.0385-0.01481.3608-0.02720.1585-0.008-0.27150.0852-0.2189-0.03130.1375-0.07060.12720.01770.01830.1339-0.01480.11153.372622.4117-25.6953
65.41972.1605-0.49333.697-0.33973.3597-0.0362-0.0032-0.2144-0.1160.0045-0.01610.1199-0.05990.02770.12040.0361-0.00640.114-0.03360.1194-3.663616.3094-24.2501
75.47412.25032.01294.16551.59113.3385-0.1561-0.1250.4109-0.04470.00990.1196-0.23020.00420.17830.110.02490.02740.0978-0.00330.1072-3.087628.8126-16.7771
85.5116-0.1424-0.43150.9846-0.09081.3166-0.0408-0.3441-0.00040.19320.05280.02960.0024-0.0661-0.01370.21440.00760.01690.14360.0070.1355-11.370746.7563-6.9948
96.4918-1.6797-3.48383.68140.51276.8823-0.17990.096-0.0676-0.0897-0.024-0.2860.12260.25270.18010.1754-0.0062-0.03110.16580.00550.16634.361452.626-18.3186
104.32430.23711.51831.05680.02812.6723-0.0783-0.21640.13620.08670.09740.1013-0.1492-0.25670.01130.15360.01820.02310.11770.00280.1158-13.711253.6013-12.1875
115.50514.8185-0.88566.57340.08921.8478-0.06420.14560.0682-0.31130.09920.0708-0.0076-0.0447-0.04820.17520.0131-0.01820.15120.01920.1068-10.584251.1459-24.1892
124.97291.0495-0.16491.5897-0.47253.24020.072-0.05060.13130.0174-0.04080.0448-0.0831-0.0766-0.00340.16730.03820.00420.08440.01810.1092-8.984955.2474-20.5304
135.58352.1068-2.36333.7969-1.35532.9206-0.2477-0.1386-0.4463-0.0906-0.0318-0.08710.28870.03570.29420.14920.0102-0.00110.105-0.01660.1194-9.022341.4475-15.2804
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection details
1X-RAY DIFFRACTION1chain 'A' and (resid 2 through 60 )
2X-RAY DIFFRACTION2chain 'A' and (resid 61 through 86 )
3X-RAY DIFFRACTION3chain 'A' and (resid 87 through 110 )
4X-RAY DIFFRACTION4chain 'A' and (resid 111 through 123 )
5X-RAY DIFFRACTION5chain 'A' and (resid 124 through 163 )
6X-RAY DIFFRACTION6chain 'A' and (resid 164 through 189 )
7X-RAY DIFFRACTION7chain 'A' and (resid 190 through 219 )
8X-RAY DIFFRACTION8chain 'B' and (resid 2 through 65 )
9X-RAY DIFFRACTION9chain 'B' and (resid 66 through 79 )
10X-RAY DIFFRACTION10chain 'B' and (resid 80 through 135 )
11X-RAY DIFFRACTION11chain 'B' and (resid 136 through 163 )
12X-RAY DIFFRACTION12chain 'B' and (resid 164 through 189 )
13X-RAY DIFFRACTION13chain 'B' and (resid 190 through 219 )

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more