PDB-8wv1: Ambient Temperature Structure of 50S Ribosomal Subunit from Therm...

Basic information

• Entry: Database: PDB / ID: 8wv1
• Title: Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus

Components

• (50S ribosomal protein ...) x 23
• (Large ribosomal subunit protein ...) x 6
• 23S rRNA
• 5S rRNA

• Keywords: RIBOSOME / Large ribosomal subunit / bacteria

Function / homology

Function:

large ribosomal subunit / transferase activity / 5S rRNA binding / ribosomal large subunit assembly / large ribosomal subunit rRNA binding / cytosolic large ribosomal subunit / cytoplasmic translation / tRNA binding / negative regulation of translation / rRNA binding / ribosome / structural constituent of ribosome / translation / ribonucleoprotein complex / mRNA binding / metal ion binding / cytoplasm

Domain/homology:

Ribosomal protein L25, long-form / Ribosomal protein L25, beta domain / Ribosomal protein L25, C-terminal / Ribosomal protein TL5, C-terminal domain / : / Ribosomal protein L31 type A / Ribosomal protein L31 signature. / Ribosomal protein L31 / Ribosomal protein L31 superfamily / Ribosomal protein L31 / : / Ribosomal protein L9 signature. / Ribosomal protein L9, bacteria/chloroplast / Ribosomal protein L9, C-terminal / Ribosomal protein L9, C-terminal domain / Ribosomal protein L9, C-terminal domain superfamily / Ribosomal L25p family / Ribosomal protein L25 / Ribosomal protein L36 signature. / Ribosomal protein L32p, bacterial type / Ribosomal protein L25/Gln-tRNA synthetase, N-terminal / Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain superfamily / Ribosomal protein L9, N-terminal domain superfamily / Ribosomal protein L9 / Ribosomal protein L9, N-terminal / Ribosomal protein L9, N-terminal domain / Ribosomal protein L33, conserved site / Ribosomal protein L33 signature. / Ribosomal protein L35, conserved site / Ribosomal protein L35 signature. / Ribosomal protein L28 / Ribosomal protein L35, non-mitochondrial / : / Ribosomal protein L5, bacterial-type / Ribosomal protein L18, bacterial-type / : / Ribosomal protein L6, bacterial-type / Ribosomal protein L9/RNase H1, N-terminal / Ribosomal protein L36 / Ribosomal protein L36 superfamily / Ribosomal protein L36 / Ribosomal protein L19, conserved site / Ribosomal protein L19 signature. / Ribosomal protein L27, conserved site / Ribosomal protein L27 signature. / Ribosomal protein L20 signature. / Ribosomal protein L22, bacterial/chloroplast-type / Ribosomal protein L14P, bacterial-type / Ribosomal protein L34, conserved site / Ribosomal protein L34 signature. / Ribosomal protein L2, bacterial/organellar-type / Ribosomal protein L35 / Ribosomal protein L35 superfamily / Ribosomal protein L35 / Ribosomal protein L33 / Ribosomal protein L33 / Ribosomal L28 family / Ribosomal protein L33 superfamily / Ribosomal protein L16 / Ribosomal protein L28/L24 / Ribosomal protein L18 / Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast / Ribosomal protein L30, bacterial-type / : / L28p-like / Ribosomal protein L27 / Ribosomal L27 protein / Ribosomal protein L20 / Ribosomal L32p protein family / Ribosomal protein L19 / Ribosomal protein L19 / Ribosomal protein L20 / Ribosomal protein L20, C-terminal / Ribosomal protein L19 superfamily / Ribosomal protein L21 / Ribosomal protein L32p / Ribosomal protein L17 / Ribosomal protein L17 superfamily / Ribosomal protein L17 / Ribosomal proteins 50S L24/mitochondrial 39S L24 / Ribosomal protein L21-like / L21-like superfamily / Ribosomal prokaryotic L21 protein / Ribosomal protein L34 / Ribosomal protein L34 / Ribosomal protein L24 / Ribosomal protein L13, bacterial-type / Ribosomal protein L3, bacterial/organelle-type / Ribosomal protein L15, bacterial-type / 50S ribosomal protein uL4 / Ribosomal protein L30, conserved site / Ribosomal protein L30 signature. / Ribosomal protein L5, conserved site / Ribosomal protein L5 signature. / Ribosomal protein L2 signature. / Ribosomal protein L29, conserved site / Ribosomal protein L29 signature. / Ribosomal protein L2, conserved site / : / Ribosomal protein L5, N-terminal

Component:

RNA / RNA (> 10) / RNA (> 100) / RNA (> 1000) / Large ribosomal subunit protein uL29 / Large ribosomal subunit protein bL27 / Large ribosomal subunit protein bL28 / Large ribosomal subunit protein uL6 / Large ribosomal subunit protein bL9 / Large ribosomal subunit protein bL33 / Large ribosomal subunit protein uL2 / Large ribosomal subunit protein uL13 / Large ribosomal subunit protein uL16 / Large ribosomal subunit protein bL19 / Large ribosomal subunit protein bL20 / Large ribosomal subunit protein bL21 / Large ribosomal subunit protein bL32 / Large ribosomal subunit protein bL34 / Large ribosomal subunit protein uL24 / Large ribosomal subunit protein uL3 / Large ribosomal subunit protein uL4 / Large ribosomal subunit protein uL23 / Large ribosomal subunit protein uL22 / Large ribosomal subunit protein uL14 / Large ribosomal subunit protein uL5 / Large ribosomal subunit protein uL18 / Large ribosomal subunit protein uL30 / Large ribosomal subunit protein uL15 / Large ribosomal subunit protein bL36 / Large ribosomal subunit protein bL25 / Large ribosomal subunit protein bL31 / Large ribosomal subunit protein bL35 / Large ribosomal subunit protein bL17

• Biological species: Thermus thermophilus HB8 (bacteria)
• Method: X-RAY DIFFRACTION / FREE ELECTRON LASER / MOLECULAR REPLACEMENT / Resolution: 3.99 Å
• Authors: DeMirci, H. / Tosun, B.

Funding support

United States, 1items

Organization	Grant number	Country
National Science Foundation (NSF, United States)	1231306	United States

• Citation: Journal: To Be Published; Title: Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus; Authors: DeMirci, H. / Tosun, B.

History

Deposition	Oct 22, 2023	Deposition site: PDBJ / Processing site: PDBJ
Revision 1.0	Nov 6, 2024	Provider: repository / Type: Initial release

Assembly

Deposited unit

A: 23S rRNA

B: 5S rRNA

C: 50S ribosomal protein L2

D: 50S ribosomal protein L3

E: 50S ribosomal protein L4

F: 50S ribosomal protein L5

G: 50S ribosomal protein L6

H: Large ribosomal subunit protein bL9

I: 50S ribosomal protein L13

J: Large ribosomal subunit protein uL14

K: 50S ribosomal protein L15

L: 50S ribosomal protein L16

M: 50S ribosomal protein L17

N: 50S ribosomal protein L18

O: 50S ribosomal protein L19

P: 50S ribosomal protein L20

Q: 50S ribosomal protein L21

R: 50S ribosomal protein L22

S: 50S ribosomal protein L23

T: Large ribosomal subunit protein uL24

U: 50S ribosomal protein L25

V: Large ribosomal subunit protein bL27

W: Large ribosomal subunit protein bL28

X: Large ribosomal subunit protein uL29

Y: 50S ribosomal protein L30

Z: 50S ribosomal protein L31

0: 50S ribosomal protein L32

13: 50S ribosomal protein L33

2: 50S ribosomal protein L34

3: 50S ribosomal protein L35

4: 50S ribosomal protein L36

a: 23S rRNA

b: 5S rRNA

c: 50S ribosomal protein L2

d: 50S ribosomal protein L3

e: 50S ribosomal protein L4

f: 50S ribosomal protein L5

g: 50S ribosomal protein L6

h: Large ribosomal subunit protein bL9

i: 50S ribosomal protein L13

j: Large ribosomal subunit protein uL14

k: 50S ribosomal protein L15

l: 50S ribosomal protein L16

m: 50S ribosomal protein L17

n: 50S ribosomal protein L18

o: 50S ribosomal protein L19

p: 50S ribosomal protein L20

q: 50S ribosomal protein L21

r: 50S ribosomal protein L22

s: 50S ribosomal protein L23

t: Large ribosomal subunit protein uL24

u: 50S ribosomal protein L25

v: Large ribosomal subunit protein bL27

w: Large ribosomal subunit protein bL28

x: Large ribosomal subunit protein uL29

y: 50S ribosomal protein L30

z: 50S ribosomal protein L31

5: 50S ribosomal protein L32

6: 50S ribosomal protein L33

7: 50S ribosomal protein L34

8: 50S ribosomal protein L35

9: 50S ribosomal protein L36

hetero molecules

Summary:

• 2.86 MDa, 62 polymers

Component details:

	Theoretical mass	Number of molelcules
Total (without water)	2,861,806	3879
Polymers	2,768,622	62
Non-polymers	93,183	3817
Water	184,708	10253

1

Summary:

• Idetical with deposited unit
• defined by author&software
• Evidence: equilibrium centrifugation

Symmetry operations:

Type	Name	Symmetry operation	Number
identity operation	1_555	x,y,z	1

Unit cell

Length a, b, c (Å)	303.800, 303.800, 434.800
Angle α, β, γ (deg.)	90.00, 90.00, 90.00
Int Tables number	76
Space group name H-M	P41

Components

RNA chain , 2 types, 4 molecules A a B b

#1: RNA chain

A a 23S rRNA

Details:

Mass: 948021.625 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria)

#2: RNA chain

B b 5S rRNA

Details:

Mass: 39494.535 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria)

50S ribosomal protein ... , 23 types, 46 molecules C c D d E e F f G g I i K k L l M m N n O o P p Q q R r S s ...

#3: Protein

C c 50S ribosomal protein L2

Details:

Mass: 30532.551 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60405

#4: Protein

D d 50S ribosomal protein L3

Details:

Mass: 22450.213 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHN8

#5: Protein

E e 50S ribosomal protein L4 / L1e

Details:

Mass: 23271.914 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHN9

#6: Protein

F f 50S ribosomal protein L5

Details:

Mass: 21061.596 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHQ0

#7: Protein

G g 50S ribosomal protein L6

Details:

Mass: 19568.926 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P0DOY8

#9: Protein

I i 50S ribosomal protein L13

Details:

Mass: 15927.903 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60488

#11: Protein

K k 50S ribosomal protein L15

Details:

Mass: 16319.142 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHQ7

#12: Protein

L l 50S ribosomal protein L16

Details:

Mass: 15993.909 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60489

#13: Protein

M m 50S ribosomal protein L17

Details:

Mass: 13750.148 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q9Z9H5

#14: Protein

N n 50S ribosomal protein L18 / TL24

Details:

Mass: 12639.845 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHQ4

#15: Protein

O o 50S ribosomal protein L19

Details:

Mass: 17188.830 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60490

#16: Protein

P p 50S ribosomal protein L20

Details:

Mass: 13779.275 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60491

#17: Protein

Q q 50S ribosomal protein L21

Details:

Mass: 11069.153 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P60492

#18: Protein

R r 50S ribosomal protein L22

Details:

Mass: 12808.055 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHP3

#19: Protein

S s 50S ribosomal protein L23

Details:

Mass: 10759.808 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHP0

#21: Protein

U u 50S ribosomal protein L25 / TL5

Details:

Mass: 23238.572 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHZ1

#25: Protein

Y y 50S ribosomal protein L30

Details:

Mass: 6799.126 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHQ6

#26: Protein

Z z 50S ribosomal protein L31

Details:

Mass: 8300.543 Da / Num. of mol.: 2 / Source method: isolated from a natural source
Details: MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR
Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SJE1

#27: Protein

0 5 50S ribosomal protein L32

Details:

Mass: 6722.050 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P80339

#28: Protein

13 6 50S ribosomal protein L33

Details:

Mass: 6632.896 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P35871

#29: Protein/peptide

2 7 50S ribosomal protein L34

Details:

Mass: 6132.449 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P80340

#30: Protein

3 8 50S ribosomal protein L35

Details:

Mass: 7506.178 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SKU1

#31: Protein/peptide

4 9 50S ribosomal protein L36 / Ribosomal protein B

Details:

Mass: 4435.411 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHR2

Large ribosomal subunit protein ... , 6 types, 12 molecules H h J j T t V v W w X x

#8: Protein

H h Large ribosomal subunit protein bL9 / 50S ribosomal protein L9

Details:

Mass: 16422.180 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: P27151

#10: Protein

J j Large ribosomal subunit protein uL14 / 50S ribosomal protein L14

Details:

Mass: 13323.612 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q5SHP8

#20: Protein

T t Large ribosomal subunit protein uL24 / 50S ribosomal protein L24

Details:

Mass: 11726.280 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: Q56435

#22: Protein

V v Large ribosomal subunit protein bL27

Details:

Mass: 8760.084 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: A0A1J1EPZ8

#23: Protein

W w Large ribosomal subunit protein bL28

Details:

Mass: 11004.160 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: A0A510IGH7

#24: Protein

X x Large ribosomal subunit protein uL29

Details:

Mass: 8670.258 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Thermus thermophilus HB8 (bacteria) / References: UniProt: A0A1J1EJJ8

Non-polymers , 3 types, 14070 molecules

#32: Chemical

A-3001 A-3002 A-3003 A-3004 A-3005 A-3006 A-3007 A-3008 A-3009 A-3010 A-3011 A-3012 A-3013 A-3014 A-3015 A-3016 A-3017 A-3018 A-3019 A-3020 ...
ChemComp-MG / MAGNESIUM ION

Details:

Mass: 24.305 Da / Num. of mol.: 3807 / Source method: obtained synthetically / Formula: Mg

#33: Chemical

T-501 Z-501 0-108 13-103 4-101 t-501 z-501 5-101 6-501 9-101
ChemComp-ZN / ZINC ION

Details:

Mass: 65.409 Da / Num. of mol.: 10 / Source method: obtained synthetically / Formula: Zn

#34: Water

ChemComp-HOH / water

Details:

Mass: 18.015 Da / Num. of mol.: 10253 / Source method: isolated from a natural source / Formula: H₂O

Details

• Has protein modification: N
• Nonpolymer details: The authors have evaluated chirality issues and distant water/ligand placements for any potential corrections.

Experimental details

Experiment

• Experiment: Method: X-RAY DIFFRACTION / Number of used crystals: 1

Sample preparation

• Crystal: Density Matthews: 6.03 ų/Da / Density % sol: 79.6 %
• Crystal grow: Temperature: 277 K / Method: vapor diffusion, sitting drop / pH: 7 / Details: 20% w/v PEG 3350 200 mM ammonium sulfate tribasic

Data collection

• Diffraction: Mean temperature: 293 K / Serial crystal experiment: N
• Diffraction source: Source: FREE ELECTRON LASER / Site: SLAC LCLS / Beamline: CXI / Wavelength: 1.29 Å
• Detector: Type: CS-PAD CXI-1 / Detector: PIXEL / Date: Jul 9, 2016
• Radiation: Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
• Radiation wavelength: Wavelength: 1.29 Å / Relative weight: 1
• Reflection: Resolution: 3.99→29.996 Å / Num. obs: 567145 / % possible obs: 86.09 % / Redundancy: 5.099 % / CC_1/2: 0.8 / Net I/σ(I): 3.85
• Reflection shell: Resolution: 3.99→4.1 Å / Num. unique obs: 56714 / R split: 0.2

Processing

Software

Name	Version	Classification
PHENIX	(1.11.1_2575: ???)	refinement
CrystFEL		data reduction
CrystFEL		data scaling
PHASER		phasing

Refinement

Method to determine structure: MOLECULAR REPLACEMENT / Resolution: 3.99→29.996 Å / SU ML: 0.6 / Cross valid method: FREE R-VALUE / σ(F): 1.33 / Phase error: 39.73 / Stereochemistry target values: ML

	Rfactor	Num. reflection	% reflection
Rfree	0.3617	1715	5 %
Rwork	0.2957	-	-
obs	0.2961	286015	86.09 %

• Solvent computation: Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL

Refinement step

Cycle: LAST / Resolution: 3.99→29.996 Å

	Protein	Nucleic acid	Ligand	Solvent	Total
Num. atoms	52969	128834	14058	12	195873

Refine LS restraints

Refine-ID	Type	Dev ideal	Number
X-RAY DIFFRACTION	f_bond_d	0.002	208896
X-RAY DIFFRACTION	f_angle_d	0.521	323592
X-RAY DIFFRACTION	f_dihedral_angle_d	16.168	105317
X-RAY DIFFRACTION	f_chiral_restr	0.032	37890
X-RAY DIFFRACTION	f_plane_restr	0.004	15383

LS refinement shell

Resolution (Å)	Rfactor Rfree	Num. reflection Rfree	Rfactor Rwork	Num. reflection Rwork	Refine-ID	% reflection obs (%)
3.99-4.1071	0.4135	91	0.3522	15458	X-RAY DIFFRACTION	56
4.1071-4.2393	0.4011	103	0.3501	15510	X-RAY DIFFRACTION	56
4.2393-4.3904	0.461	107	0.3356	16839	X-RAY DIFFRACTION	61
4.3904-4.5656	0.4188	127	0.3276	20000	X-RAY DIFFRACTION	78
4.5656-4.7726	0.3736	144	0.3147	20000	X-RAY DIFFRACTION	90
4.7726-5.0231	0.3534	161	0.3155	20000	X-RAY DIFFRACTION	95
5.0231-5.3362	0.4028	155	0.3086	20000	X-RAY DIFFRACTION	97
5.3362-5.7456	0.3571	165	0.3007	20000	X-RAY DIFFRACTION	99
5.7456-6.3189	0.358	167	0.3015	20000	X-RAY DIFFRACTION	100
6.3189-7.2221	0.3851	166	0.2912	20000	X-RAY DIFFRACTION	100
7.2221-9.0573	0.3338	166	0.2737	20000	X-RAY DIFFRACTION	100
8-10	0.2669	163	0.2205	20000	X-RAY DIFFRACTION	100

Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

ID	L11 (°2)	L12 (°2)	L13 (°2)	L22 (°2)	L23 (°2)	L33 (°2)	S11 (Å °)	S12 (Å °)	S13 (Å °)	S21 (Å °)	S22 (Å °)	S23 (Å °)	S31 (Å °)	S32 (Å °)	S33 (Å °)	T11 (Å2)	T12 (Å2)	T13 (Å2)	T22 (Å2)	T23 (Å2)	T33 (Å2)	Origin x (Å)	Origin y (Å)	Origin z (Å)
1	0.5987	-0.2186	0.095	0.3862	-0.0984	0.0597	-0.0368	-0.2156	-0.0393	0.1053	0.1458	0.1389	-0.0767	-0.2704	0.2461	0.548	0.3701	-0.231	0.5574	0.1788	0.7312	82.694	132.2657	-20.3734
2	0.1496	0.0365	0.0087	0.0196	-0.0208	0.0447	-0.0489	0.1441	0.0748	-0.0452	0.1063	0.1451	-0.0938	-0.0524	0.1439	0.5	-0.2203	0.1702	0.2263	0.0829	0.5682	104.7272	93.7875	-58.9542
3	1.3107	-0.498	0.1887	1.0675	-0.4735	0.804	0.3747	0.6009	0.018	-0.8069	-0.1577	-0.1796	0.0198	0.4563	-0.1587	0.9788	-0.0518	0.0747	0.7551	-0.0429	0.4692	135.9237	103.2882	-78.6829
4	1.0371	0.0899	-0.6072	2.0369	0.3128	4.1235	-0.5679	0.0608	-0.2802	-0.0296	-0.4456	-0.0741	0.4403	-0.4285	0.7392	0.434	-0.005	0.0143	0.4322	-0.0157	0.5728	131.4019	71.7866	-51.7558
5	0.7452	-0.3468	-0.0113	0.3738	0.2895	1.4095	-0.0165	-0.1215	-0.1417	-0.1589	0.0361	0.3788	0.1929	-0.3275	0.0933	0.8528	0.0399	-0.104	0.3904	-0.2048	1.0995	117.9328	49.4201	-54.7175
6	1.8614	-0.6265	-1.37	2.0213	-1.4175	4.4234	-0.2798	-0.5463	0.6563	0.3318	-0.2237	-0.8522	-0.7283	-0.0331	0.5075	0.7744	0.0299	-0.4278	1.3882	-0.5703	1.6388	162.5975	45.1248	-80.2264
7	2.2058	-0.0116	-1.5226	1.1662	-1.0111	2.6219	-0.0203	0.2458	-0.0271	-0.111	0.01	0.611	0.155	0.2989	-0.0568	1.1923	-0.0138	0.082	0.8989	-0.4576	0.7298	139.8402	36.0112	-82.6229
8	2.7699	0.8863	0.2749	0.2869	0.1312	1.2815	0.526	1.1924	-0.5931	-1.2202	0.0296	0.0717	0.2888	-0.3038	-0.2243	1.2871	-0.1274	-0.0241	0.8862	-0.0229	0.5586	118.0255	70.0586	-89.2733
9	1.6499	0.544	-0.7571	1.808	1.1233	1.4553	-0.1306	-0.3359	0.1846	-0.5315	-0.0108	0.3331	0.3314	0.3166	0.1598	0.8995	0.1588	-0.0149	0.5954	-0.1065	0.3707	91.1572	94.0427	-82.2014
10	1.1902	-0.0985	-0.7198	0.405	-0.0396	0.9781	0.0253	0.3489	-0.0782	0.1233	0.1442	-0.2447	0.4225	-0.3123	-0.0077	0.5704	-0.1169	-0.045	0.5391	-0.3022	0.8263	137.1233	42.3311	-59.0461
11	1.1701	0.6414	-0.0239	0.3612	0.0142	1.7848	0.2777	0.1256	0.002	-0.2742	0.1033	-0.1445	0.8096	-0.4212	-0.1811	0.978	-0.0449	0.1115	0.5224	-0.1802	0.7226	134.4873	43.746	-57.6022
12	0.8267	-0.5204	-0.1198	1.3464	0.5334	0.2502	-0.2812	0.2937	0.0256	0.3944	-0.0027	0.4442	-0.1345	0.3199	0.1709	0.8441	-0.143	-0.149	0.5608	0.003	0.578	108.8042	110.8685	-55.6229
13	0.5923	-0.2842	-0.2522	2.0828	-0.9064	0.6501	-0.1904	0.5502	0.2699	-0.6152	-0.325	0.4044	-0.2297	0.1604	0.1743	0.7719	0.1591	-0.2063	0.6319	0.1517	0.8743	93.1699	122.6633	-53.9131
14	0.6191	-0.0091	-0.8042	1.2236	0.0002	1.0228	0.0878	0.214	0.1643	-0.2278	0.0468	0.0372	-0.1205	-0.2335	-0.1072	0.6525	0.3534	-0.0879	0.5497	-0.1178	0.9958	78.46	124.4166	-18.7084
15	0.5317	0.1151	-0.1209	0.5261	-0.4445	0.9348	-0.2101	-0.0396	0.0251	0.2347	-0.2495	0.3732	0.0783	-0.2759	0.2989	0.7044	0.3305	0.2587	0.7159	-0.0787	0.9401	69.2806	120.4493	-19.0938
16	0.4478	0.4955	0.3817	0.7644	0.7971	0.9199	-0.1301	-0.022	-0.0854	-0.2005	0.1657	-0.1024	-0.3843	0.2851	0.0165	0.4329	0.1805	-0.0424	0.5458	0.1325	0.3426	95.3674	90.8177	-22.8821
17	2.4222	-0.325	-2.0468	0.3362	-0.251	2.6566	-0.072	0.5368	-0.7703	-0.3886	0.1905	-0.1667	-0.4572	0.0348	-0.1969	0.9413	-0.2593	-0.1744	0.8728	-0.2644	0.6588	90.0096	60.2485	-59.9326
18	3.2816	-0.4403	1.0596	1.7077	0.0728	3.3595	-0.3611	-0.5071	0.047	-0.1586	0.1819	0.5197	-0.4054	0.0965	0.1974	0.7927	-0.1136	0.0917	0.7869	-0.2213	1.0288	96.9301	39.2167	-41.4506
19	1.4793	-1.667	1.5263	6.7283	-3.2697	6.5556	-0.0727	-0.1127	0.092	-0.1296	0.2954	0.3954	-0.0117	-0.9143	-0.2091	1.4322	0.1988	-0.26	1.208	0.5629	0.8626	97.4144	20.6191	-18.9795
20	7.8394	3.4316	-0.6392	4.5046	-1.7572	2.6124	0.1872	-0.5653	-0.7553	0.0799	0.0167	0.036	0.0091	-0.3985	-0.1309	0.4758	-0.2935	0.1794	1.3029	-0.3853	0.8437	89.4267	34.5438	-23.8867
21	3.0813	1.328	-1.6435	0.5725	-0.7086	0.8767	0.0357	-1.0327	0.058	-0.7153	-0.1358	3.0561	-0.3209	-4.0494	0.0908	1.2037	0.5044	-0.0359	3.0978	-0.3938	2.2484	64.5555	43.6582	-40.4723
22	0.5203	-0.0195	-0.2215	0.1899	-0.0688	0.0012	0.0234	-0.1529	-0.2081	0.1791	-0.047	0.0606	-0.0369	0.0496	0.0153	0.622	-0.0199	0.0054	0.4878	0.0281	0.5211	119.2549	81.6335	-5.3658
23	1.1454	0.2476	0.2254	1.0549	-0.3261	1.1204	0.0368	-0.432	0.0861	0.3398	0.1391	0.1831	0.1948	-0.1846	-0.0917	0.5345	0.1224	0.1414	0.3974	0.0166	0.6514	74.7827	98.6281	22.603
24	1.412	0.9875	-1.1404	4.3368	0.9477	2.0209	0.5448	-1.6929	-0.6528	3.2165	-0.8658	-0.5735	0.6514	1.5122	0.2318	2.5153	-0.322	-0.2949	2.2107	0.5722	1.8109	95.5511	96.9778	71.2049
25	0.5707	0.0391	-0.1461	0.6041	0.2552	1.3908	0.1132	-0.0094	-0.3087	0.0016	-0.016	0.0839	0.2036	-0.2299	0.0056	0.5658	0.1664	-0.1891	0.4304	-0.0613	0.7127	70.7563	91.7852	-14.7049
26	0.121	0.1842	-0.0296	0.5126	0.2151	0.0698	-0.0289	0.0652	-0.0905	-0.1508	0.0711	-0.013	-0.1516	-0.0151	-0.0396	0.6366	0.1297	-0.0123	0.4799	0.1491	0.3529	129.4777	118.3535	-46.9961
27	0.7547	-0.1817	0.1858	1.4444	0.4698	0.1858	0.0719	0.1339	-0.2321	-0.2528	-0.1385	0.19	-0.2278	0.2389	0.0551	0.6721	-0.1189	0.1609	0.6296	0.0824	0.4712	182.4769	129.4701	-49.2953
28	0.1879	0.1064	-0.0581	0.288	-0.1107	0.1889	0.0424	0.0342	-0.0495	-0.0884	-0.0552	-0.152	-0.0224	0.0463	-0.012	0.5373	0.0146	0.0501	0.4135	-0.0032	0.4316	154.9196	107.0733	-12.9283
29	0.8694	0.5055	-0.2752	0.4669	-0.2455	1.101	-0.1763	0.0771	-1.1988	-0.2334	-0.0698	0.1039	1.1376	0.3955	-0.1079	1.2989	0.3892	0.029	0.9537	0.0746	1.1308	150.4697	49.5568	-22.6343
30	2.6388	0.7776	1.4122	3.6342	-0.364	1.7409	0.6866	-0.8814	-3.101	0.8073	0.0698	-0.8483	2.109	0.6463	-0.3628	4.4881	0.969	0.7104	2.5705	0.6621	4.2248	180.6285	14.2153	-32.4279
31	0.062	-0.027	0.0287	0.0683	0.0681	0.1221	-0.0083	0.0392	-0.076	0.0341	-0.0307	0.0495	0.0405	-0.0301	0.0393	0.5235	-0.0029	0.0394	0.5244	0.0462	0.6113	116.1592	92.4064	12.2542
32	1.7388	-0.6341	1.5297	4.8019	-5.2565	6.6048	0.9623	1.0608	-0.0618	-1.0964	0.6669	1.6301	0.9923	-1.1527	-1.4034	1.0605	0.4806	-0.0782	1.8408	0.1571	1.4061	79.8899	156.5629	-17.1267
33	0.5305	0.1956	-0.0043	1.7835	1.4462	1.2279	-0.2961	0.4481	0.2254	-0.2783	-0.1253	0.4575	-0.2534	0.0053	0.0511	0.4351	-0.1689	-0.041	0.3358	0.1071	0.4735	108.314	154.9306	-8.9618
34	1.1993	1.4378	-1.1867	1.7254	-1.4239	1.1748	0.3382	0.3775	0.0482	-0.0672	0.1288	0.6223	0.3995	-0.3953	-0.1157	0.764	-0.1025	-0.1241	0.5735	-0.262	0.8419	116.9718	171.2677	-9.984
35	0.5399	-0.0519	-0.042	0.4491	-0.0192	0.8667	0.0363	0.0519	-0.2256	-0.3488	-0.0546	-0.1176	0.397	-0.0765	0.0183	0.6432	-0.0696	0.0451	0.2251	-0.136	0.4343	153.3659	171.6119	-3.2141
36	0.0341	0.1746	-0.1981	1.4829	-0.5018	1.3296	0.3722	-0.0194	-0.3238	0.0105	0.2089	0.6456	-0.1252	-0.4462	-0.5667	0.7714	0.2294	0.0927	0.8157	0.1335	1.0609	102.1818	163.6969	-11.336
37	0.7139	-0.5297	-0.29	3.7042	-0.6604	2.1815	-0.1796	-0.0715	-0.7512	0.46	0.3643	-0.1149	-0.2597	-0.6369	0.0282	0.7228	0.3705	0.2955	0.8069	0.2295	1.4183	76.9158	25.3157	36.93
38	0.7472	0.1229	-0.6228	0.0373	0.0012	1.227	-0.3702	-0.1153	-0.4533	0.6614	0.3368	0.5676	0.7474	0.0719	0.1285	1.121	-0.0328	0.2532	0.5925	0.2087	1.3566	90.1739	11.3121	42.1853
39	0.5469	-0.8683	0.3035	1.501	-0.9625	2.1723	0.0358	-0.1449	-0.8334	0.4106	0.3527	0.606	-0.3013	-0.2998	-0.2842	0.4979	-0.0699	-0.0007	0.629	0.1251	0.8702	76.7796	65.276	31.0179
40	1.7764	-0.8998	-0.7458	0.4587	0.451	1.3547	-0.2097	-0.0787	0.0461	0.1023	-0.1173	-0.1137	-0.049	-0.2505	-0.4876	1.0046	0.1972	0.4053	0.5651	-0.2011	0.8698	68.4122	14.5688	32.0714
41	0.0257	0.0789	-0.1571	0.3812	-0.2472	1.1454	-0.0761	-0.2787	-0.0739	0.3491	-0.0355	0.0333	-0.0327	0.3755	0.0365	0.4223	-0.0472	0.1686	0.8173	0.0524	0.2932	176.3594	97.0086	-27.2141
42	0.6101	-0.1341	-0.1208	0.0653	-0.0325	0.1384	0.0929	0.0302	-0.1512	0.0505	0.0738	-0.0055	0.0307	0.3522	0.2203	0.5938	0.0661	0.2839	0.4841	-0.1358	0.5598	194.1779	83.8471	-35.669
43	1.0362	-0.2022	-0.1911	0.0698	0.0735	0.1897	-0.3084	0.235	-0.5698	0.0542	0.2375	0.1432	0.1324	0.1137	0.088	0.226	-0.0886	0.1547	0.5485	-0.0528	0.3996	173.9126	79.1236	-21.894
44	0.0613	-0.0436	-0.0247	0.0612	-0.0351	0.0993	-0.0297	-0.0255	0.1238	0.0645	0.0084	-0.0043	-0.0321	-0.0444	-0.0649	0.4672	0.3139	0.2715	0.8951	-0.158	0.9148	175.5445	63.7798	-24.5867
45	0.2631	-0.2099	0.028	0.4371	0.13	0.3859	0.0724	0.0197	0.0705	0.0351	0.0932	-0.27	0.1931	0.3131	-0.0237	0.4907	0.2128	-0.002	0.291	-0.1061	0.2039	113.3143	162.8355	19.6759
46	3.0814	-0.3505	1.2968	0.9903	1.0092	1.9684	-0.1814	-0.3985	0.1974	-0.312	-0.1685	-0.8234	-0.7183	-0.0374	0.2303	0.4372	0.0378	0.0362	0.3346	0.0873	0.6952	97.108	165.2248	13.5667
47	0.6836	-0.2168	-0.2135	0.4628	0.2542	0.5769	0.1093	-0.1394	0.0177	-0.5177	0.073	0.2581	0.0318	-0.0391	0.1365	0.4144	0.0739	-0.1006	0.2327	0.0284	0.2792	117.3346	131.182	5.7826
48	0.7953	-0.2512	0.291	0.7109	-0.2883	1.261	-0.0859	0.319	-0.0796	0.1471	-0.1505	0.0501	0.1699	0.2202	-0.4694	0.2253	0.0995	-0.0169	0.3533	-0.1154	0.1557	112.2076	158.3573	19.5
49	1.8031	-1.1184	0.2888	1.6286	-0.3928	0.4196	-0.2138	-0.0751	-0.2782	0.2874	0.0831	0.0168	-0.1798	-0.1646	0.0663	0.5609	0.4418	0.0313	1.019	0.076	1.2125	64.8766	62.0805	-72.0091
50	0.3046	-0.0566	-0.0961	0.244	-0.0886	0.8344	-0.0332	0.0947	0.0066	0.0141	-0.0746	-0.043	0.0278	-0.2847	-0.0576	0.5237	0.0677	-0.3519	0.3316	-0.1679	0.5156	89.3311	74.9138	-54.7455
51	0.2542	-0.0552	0.2029	0.3994	0.0008	0.6994	-0.0908	-0.0603	-0.0559	-0.0521	0.1137	0.0972	-0.0071	-0.0999	-0.1318	0.2394	-0.0442	-0.1229	0.1996	0.124	0.2152	118.1785	94.7118	-32.9144
52	0.5985	-0.5392	0.2232	0.7431	-0.0157	0.4075	0.0451	0.0181	-0.0957	-0.0909	-0.0857	0.1447	0.0273	-0.0056	0.074	0.339	0.1595	0.1237	0.3938	0.2099	0.8182	103.8063	83.4462	-43.464
53	0.0819	-0.0035	0.012	0.2406	0.0935	0.1637	0.0063	-0.079	0.0584	0.0774	0.0203	-0.1155	-0.0609	0.1396	0.0419	0.6393	-0.2704	-0.2347	0.5802	-0.2896	0.6437	75.2761	63.7627	-61.6838
54	0.977	0.4	-0.5432	2.2432	-0.6701	0.5847	-0.2532	0.2013	-0.4913	-0.0596	0.2253	-0.2346	0.324	0.2945	-0.0374	0.7918	0.0773	-0.0585	0.4746	-0.2842	0.4664	70.8137	76.0408	-81.5486
55	0.1826	0.3681	0.1975	0.7351	0.3496	0.378	0.0067	-0.01	-0.0126	0.124	0.1694	-0.0787	0.0088	0.3084	-0.1594	1.0461	-0.053	-0.0481	0.4817	-0.2141	0.5175	79.8677	74.816	-74.6239
56	0.1847	-0.0399	-0.152	0.0514	0.0036	0.1358	-0.0372	0.1602	-0.1263	-0.0212	0.0484	-0.0212	-0.0137	0.0352	0.208	0.4441	-0.2864	0.2556	0.5389	-0.2753	0.4339	76.0031	62.4964	-73.6665
57	4.1314	-4.3168	-4.6977	4.8405	5.0694	5.4205	-0.175	-0.1144	1.0519	-1.0428	-0.2315	-0.0836	-1.1114	-0.7137	0.339	1.2513	0.3867	-0.0207	1.1445	-0.2657	1.1044	102.4313	3.3056	61.205
58	0.7134	0.7675	-1.287	0.824	-1.4862	4.4435	-0.8186	-0.2177	-0.5585	0.4706	-0.581	-0.025	0.5525	0.7147	0.745	1.1049	0.3909	0.038	0.8024	0.0281	1.6327	116.0772	18.208	42.2342
59	4.075	-1.4842	1.5279	0.7853	-0.9696	1.2702	1.5427	-0.678	-1.9636	1.3528	-0.3268	-0.7907	0.5201	0.7349	-1.0324	1.8674	-0.0319	-0.6532	1.5358	0.081	1.8859	117.8011	8.4583	55.6285
60	0.8967	-0.1225	-0.7435	0.4028	0.0663	1.5016	-0.2161	0.4666	-0.085	-0.6423	0.8463	-0.2478	0.713	0.7109	-0.4578	1.3461	0.3414	0.6349	1.3636	-0.0469	1.6183	121.5304	16.5857	53.3632
61	1.9944	0.5555	2.1222	2.6005	-1.4432	3.9506	-0.3048	0.7659	-1.1143	-0.9932	0.3261	-1.2228	-0.0269	1.2286	0.0604	0.9937	-0.5045	0.3284	1.0243	-0.1292	1.5218	107.3925	18.0103	52.7945
62	0.7475	0.075	0.6091	2.701	0.4883	3.3981	0.1183	0.4869	-0.2607	0.0279	0.102	-0.3588	-0.4822	0.7197	-0.1692	1.1009	-0.3661	-0.2518	2.1528	-0.0377	0.6725	108.37	15.9064	64.569
63	0.4858	-0.6213	0.826	1.0301	-1.0178	1.4572	0.2834	-0.0853	-0.0628	-0.1886	0.0113	-0.2159	0.0359	-0.5276	-0.2503	0.4221	0.0275	-0.0478	0.7788	0.5382	1.089	67.1891	123.1416	63.5073
64	2.7455	1.4277	-0.484	3.9998	1.1651	0.7026	-0.3753	0.6772	0.5602	-0.149	-0.7616	0.9924	0.1649	-0.7849	1.0545	0.6074	-0.1558	-0.1122	1.6966	-0.1769	1.1395	67.1685	131.8562	53.3109
65	0.7074	-0.316	0.4658	1.2092	-0.0065	0.342	0.0106	-0.0573	0.0936	0.0474	0.0174	0.2618	-0.0757	-0.255	0.0316	0.2044	0.1672	-0.0418	0.7837	0.0159	0.7923	63.0838	119.1073	55.6278
66	1.2914	-0.1238	0.4694	0.195	0.3297	0.8991	0.0343	0.2548	-0.2041	0.1183	0.0292	0.0639	0.1312	0.228	-0.0038	0.5311	0.07	0.2164	0.1814	-0.0249	0.2678	78.2915	126.01	59.8568
67	4.2803	1.2232	-0.4466	2.6106	1.1149	4.0869	-0.0336	0.1322	0.0234	0.1435	0.0264	0.1005	-0.2835	-0.0322	0.0414	0.818	0.2263	-0.3992	1.1215	0.1993	0.7566	104.3728	141.1598	67.2186
68	3.3949	0.129	-1.2538	0.4192	0.1948	0.6035	0.3612	0.0708	1.1404	-0.198	0.1639	-0.4577	-0.5388	0.1489	-0.4081	0.7255	0.0238	0.3753	0.5369	-0.1795	0.822	94.7063	138.6527	61.3229
69	0.7724	0.4602	0.459	0.288	0.2691	4.0954	-0.0103	-0.0492	-0.0459	-0.0855	-0.0953	0.0012	0.3501	0.0383	-0.0382	0.7409	0.0987	0.0041	0.2444	-0.0087	0.1568	105.3994	123.682	66.4719
70	3.0162	-1.1781	0.9144	1.4762	1.1869	2.6485	-0.5067	0.1537	-0.5592	-0.6408	0.3683	-0.6077	0.5166	0.1326	0.149	1.6327	0.1078	0.4228	0.6845	-0.1524	0.9882	174.1252	35.6188	-66.3897
71	5.0193	1.2366	-4.3589	3.6279	1.0973	5.204	-0.2205	3.0779	3.8729	-4.1504	0.729	2.1033	-3.186	-1.4807	-0.4951	2.5305	0.0977	0.2173	2.7694	0.1233	2.511	191.1035	12.862	-90.1475
72	0.0541	0.1384	-0.1539	0.4084	-0.2687	0.6703	0.0534	0.3084	-0.1399	-0.0994	-0.0545	0.0316	0.1009	0.0923	0.0691	0.464	0.1197	0.2304	0.4457	-0.1673	0.3721	58.3753	124.4495	-4.7178
73	0.506	-0.1345	0.1773	0.0503	-0.137	1.9909	0.2479	0.007	0.2381	-0.0377	0.268	0.2103	-0.1815	-0.0121	0.2439	0.6284	0.1953	-0.035	0.2479	-0.0422	0.6665	66.0181	126.4824	12.9781
74	0.6021	0.0214	0.5351	1.2657	-0.9388	1.4623	-0.0375	-0.0466	0.0343	0.1597	0.1333	0.1684	-0.2028	-0.241	-0.1005	0.3474	0.117	-0.0541	0.3336	0.1346	0.2628	86.8444	123.4092	23.1676
75	0.2624	-0.3752	0.152	0.5535	-0.1801	0.1747	-0.0981	-0.1205	-0.1356	0.0356	0.0255	0.0064	0.1201	0.0925	-0.0519	0.4306	0.2741	0.2648	0.4035	0.2336	0.3099	87.0017	129.3832	25.1835
76	0.7314	-0.5212	0.5338	0.537	-0.272	0.4604	-0.0919	-0.0529	0.0997	0.0506	0.0043	-0.083	-0.029	0.0568	0.0359	0.3474	0.2987	0.0848	0.9063	0.289	0.3808	78.0731	127.2544	16.9644
77	0.7342	0.2054	-0.0421	1.2349	-0.0868	0.9802	0.0019	-0.024	0.3082	0.1223	-0.0421	0.1834	-0.3015	-0.1732	-0.0641	0.4676	0.2678	0.034	0.3282	-0.043	0.6852	74.8477	127.4764	5.6524
78	2.7951	-1.1067	0.8613	1.5866	-1.7091	4.1485	0.1759	0.3878	0.0308	-0.2281	-0.0427	-0.2543	0.0092	-0.0596	-0.0558	0.4201	0.2698	0.1701	0.6989	-0.0699	0.7097	69.0021	140.7423	18.8696
79	2.6731	1.5571	-0.863	3.3938	-1.8171	1.7473	0.0518	0.1293	0.1903	-0.0402	-0.0526	-0.0499	-0.0282	-0.0562	-0.0543	0.072	-0.0063	-0.0064	0.233	0.1164	0.1509	59.4659	135.6604	15.3021
80	2.6547	-0.4369	-1.0309	1.3405	0.0804	0.9246	-0.1935	0.0084	-0.4147	-0.0602	-0.0499	0.0286	0.1562	0.0531	0.0255	0.2066	0.1278	0.0715	0.4158	-0.0736	0.2487	144.7755	133.7917	23.3451
81	3.6728	-0.8726	-2.0349	0.2168	0.364	2.6503	0.0744	-0.1252	0.0674	0.0773	0.0041	0.0548	-0.0894	-0.0411	-0.112	0.309	-0.1503	0.1682	0.4404	0.0905	0.4324	156.3616	135.8827	34.3244
82	0.1044	0.1196	-0.1643	0.4875	-0.063	0.3062	-0.0299	-0.085	0.3289	0.0605	0.032	-0.0075	-0.0976	0.0633	-0.0078	0.5183	-0.1759	-0.0233	0.1802	-0.142	0.4492	144.6367	129.856	28.0895
83	1.0008	0.5508	0.6746	0.2999	0.3758	1.0475	-0.0118	0.0874	-0.0378	-0.0103	0.0389	-0.0496	0.099	0.059	-0.0458	0.3325	0.0923	-0.2158	0.6002	-0.0761	0.2404	137.3797	133.946	29.79
84	0.1229	-0.1094	-0.1227	1.4597	0.4923	0.3426	0.0502	-0.0252	-0.0606	0.0528	0.074	-0.1808	0.1277	0.153	0.0078	0.284	0.0947	-0.1413	0.0622	-0.0823	0.1025	153.538	130.1162	33.4066
85	0.1499	0.0066	-0.1168	0.1541	0.0438	0.4741	0.1088	0.1507	0.0723	-0.2212	-0.1264	0.0579	-0.0969	-0.1497	0.0175	0.4176	0.2201	0.0012	0.2571	-0.0317	0.1798	143.3318	147.059	26.3214
86	2.7313	2.5012	-1.3107	5.4326	-1.4379	0.6861	0.0614	-0.4936	-0.5875	-0.1388	-0.3499	-0.5917	0.0709	0.1077	0.2139	0.6227	-0.2085	-0.1356	0.3121	0.1148	0.2906	148.7625	136.0232	43.5606
87	0.1166	-0.0369	0.0501	0.0245	-0.0469	0.1216	0.0106	0.0202	-0.0091	-0.0305	0.0213	0.0146	0.0143	-0.0489	0.0517	0.0349	-0.059	-0.0565	0.2656	0.1149	0.0648	146.4277	147.8865	37.3807
88	0.387	-0.1872	0.4789	1.3748	0.7109	5.2157	0.4438	0.8846	0.1361	-0.3329	-0.3034	0.4528	-1.241	-1.1322	-0.2058	0.7249	0.4356	0.0766	1.367	-0.1353	0.4986	72.8537	75.5838	-52.8522
89	2.8396	0.8108	2.1603	0.6095	0.8829	1.8313	-0.0915	-0.3059	0.0606	-0.1092	-0.0431	0.0532	-0.1322	-0.4398	0.0822	0.7776	0.0019	-0.2683	0.8214	0.2967	0.5061	87.0271	81.5081	-34.7161
90	0.4844	0.1425	0.3212	0.0904	0.0285	0.3322	0.0994	0.4082	-0.0961	-0.1204	-0.0119	-0.1438	0.0956	0.219	0.4246	0.4774	0.186	0.4424	0.3102	-0.0773	0.4616	105.7268	63.7692	-22.9828
91	0.2921	0.0261	-0.1832	0.2614	0.0718	0.1653	0.0474	-0.0683	-0.0345	-0.0179	0.2089	-0.2117	-0.313	0.0804	-0.1739	0.4174	-0.173	0.2263	0.5617	-0.0819	0.3829	100.1899	34.0059	-44.3993
92	4.7549	-3.1979	-4.0327	2.158	2.6913	3.5049	0.0807	0.6405	-0.3088	-0.1942	-0.2285	0.3175	0.0217	-0.4161	0.181	0.8571	0.3978	0.2695	1.1508	-0.2818	1.2278	84.4075	30.4624	-55.9368
93	0.489	1.1125	-0.6679	3.1765	-1.3	1.4675	0.0577	-0.0086	-0.0996	-0.1217	0.0802	0.1856	0.1697	-0.1478	-0.0503	0.2295	-0.0349	-0.0827	0.201	0.1312	0.7617	94.2449	37.5046	-53.5901
94	0.0726	-0.1471	-0.0957	0.2949	0.1985	0.1343	-0.2346	-0.0708	-0.2891	-0.1081	-0.1517	-0.0635	0.0717	0.321	0.0189	0.3432	-0.2108	0.1896	0.5897	0.0629	0.8575	89.7128	23.8469	-47.3832
95	3.2113	1.041	-1.4567	4.7416	-1.0054	0.7665	-0.1091	-0.5092	-0.079	0.4006	-0.1951	0.3822	0.5893	0.1927	0.2668	0.7956	-0.2355	0.1152	0.6177	0.1894	1.1268	111.2688	64.1163	35.1973
96	1.7959	1.8097	-1.8462	2.7164	-2.2626	2.0825	0.3824	-0.3759	0.1716	-0.5325	0.2048	-0.0148	0.0729	-0.0899	-0.2947	0.6031	0.1726	0.1461	0.9012	0.3228	0.5565	94.0647	70.2119	35.6612
97	3.4292	0.8625	1.3561	4.0611	1.4552	0.859	-0.5148	0.7661	0.488	0.023	0.0471	0.1123	-0.5985	0.3559	0.4124	0.6706	-0.3776	-0.1316	0.7351	-0.0672	0.5111	91.7113	78.4793	46.759
98	0.3439	-0.1689	0.5557	0.1227	-0.1225	1.4958	-0.0072	-0.0497	0.1652	0.07	0.0675	-0.1547	-0.0946	-0.1691	0.0855	0.2128	0.0454	-0.1363	0.3592	0.0445	0.7511	105.4837	79.3953	46.6805
99	2.6909	-1.1158	1.4971	2.2628	1.7844	4.1336	-0.0847	-0.0547	0.4351	-0.223	0.1152	-0.8438	-0.442	1.2209	-0.0876	0.3755	-0.1715	0.1982	1.1259	0.1463	1.1669	104.0211	75.1563	58.1458
100	0.4146	0.2035	0.4997	0.0971	0.2426	0.6012	0.452	-0.0173	0.3665	-0.2346	0.2135	0.1662	-0.8765	0.1514	-0.5968	0.4504	-0.0362	0.0732	0.2532	-0.1236	0.8954	104.4488	71.5757	34.8182
101	0.3173	-0.1178	-0.3182	0.0825	0.0392	0.4737	0.0173	-0.0647	0.0998	0.0926	0.034	-0.0452	-0.0521	0.0122	0.0413	0.4947	0.175	-0.1183	0.2414	-0.1654	0.3052	114.8691	79.0427	17.4026
102	0.523	-0.6253	0.2775	1.8305	0.2206	0.5299	0.1725	0.1343	0.2247	-0.1777	-0.2065	-0.3922	-0.1322	0.2245	-0.1595	0.1774	-0.0301	0.0226	0.1653	0.2036	0.37	107.9789	73.5455	32.5796
103	0.4934	0.3776	0.8762	1.9882	3.7666	7.2047	-0.0045	-0.0251	-0.06	0.3662	-0.0761	-0.0197	-0.1355	0.6738	0.1997	1.223	-0.093	0.3369	1.0118	0.5678	1.1277	94.4347	74.9276	48.7986
104	0.2468	0.0676	0.2762	0.1037	-0.0059	0.4272	0.0462	0.1813	-0.1092	0.0368	0.0923	-0.1377	0.0056	0.1815	-0.2356	0.538	0.1594	0.1948	0.3745	-0.1114	0.464	95.003	84.0273	50.6935
105	3.7852	0.2602	-2.7613	4.6407	0.2832	5.427	-0.0924	-0.6318	-0.1344	1.0454	0.0062	0.1641	0.092	0.3229	0.0549	0.559	-0.0278	0.1844	0.6627	0.064	0.2344	82.8619	69.2955	52.9319
106	0.081	0.1234	0.1528	0.2846	0.0865	0.5315	0.0007	-0.3318	0.1422	-0.1647	0.2027	-0.1647	0.1825	0.1125	-0.1096	0.7357	-0.0243	-0.1267	0.7879	-0.4267	0.7317	126.1063	151.0377	-9.8341
107	0.1018	0.0272	-0.023	0.0674	-0.1083	0.2526	-0.0769	0.0538	-0.1342	-0.1031	0.0939	0.0235	0.0869	-0.0761	-0.0785	0.139	-0.0807	-0.0496	0.2722	0.2362	0.4051	134.4393	158.6372	-23.7002
108	0.1185	0.1479	0.0134	0.3177	0.2262	0.3369	-0.0011	-0.0405	-0.116	-0.0213	0.0071	0.0455	0.08	-0.0063	0.2811	0.661	0.0869	-0.045	0.2021	0.2472	0.5085	129.0664	165.3098	-20.3462
109	0.114	0.0452	0.0524	0.0179	0.0341	0.4997	-0.0325	0.0002	0.0554	0.0348	0.0102	0.0332	-0.1577	-0.1017	0.0813	0.2714	0.2187	-0.1002	0.2211	-0.0583	0.1401	143.5351	170.3468	-22.453
110	0.5992	0.0587	-0.3402	0.1651	-0.0214	0.4132	-0.2111	0.1848	0.0348	-0.3734	0.1044	-0.3217	-0.0731	0.0854	0.0449	0.7783	-0.1726	0.1477	0.2776	-0.0898	0.7045	129.7976	178.499	-22.0075
111	0.5081	-0.0873	0.2339	0.2951	-0.0903	0.1401	0.0307	0.017	0.0512	0.0145	0.0149	0.0463	-0.0322	-0.0144	0.0773	0.2259	0.0661	0.1307	0.0741	0.0725	0.2453	119.265	165.9798	-24.3338
112	0.7916	0.2511	0.6266	0.7749	1.2424	2.8472	0.11	0.2282	-0.0081	-0.1369	-0.0907	0.0962	0.0274	-0.0358	0.1567	0.2858	-0.0631	-0.182	0.3257	0.1009	0.2597	115.7373	150.8564	-30.8955
113	1.2879	-0.363	-0.2866	0.188	0.0343	0.2817	0.162	-0.3296	0.5643	0.0172	-0.0248	-0.1079	-0.2282	0.2169	-0.3882	0.3473	-0.0356	0.2644	0.4442	-0.1813	0.5689	122.466	167.5816	-27.5515
114	0.5651	0.1008	0.5462	0.219	0.1056	0.5292	0.0602	0.0422	-0.1619	-0.0391	-0.0602	-0.1135	0.0733	-0.0776	-0.0805	0.2938	-0.1194	0.2321	0.612	0.0391	0.6322	91.4299	21.5962	24.5054
115	0.9089	-0.7075	0.8154	0.8932	-0.4519	0.8306	0.018	0.0446	-0.2036	-0.0882	-0.185	-0.1836	0.421	0.7936	0.072	0.4255	0.2793	0.146	0.9364	-0.1003	1.3182	80.319	8.433	23.6141
116	0.7724	-0.2237	-0.4032	2.8492	1.0446	1.1187	-0.0423	1.1882	0.2197	-0.4384	-0.0821	-0.2367	-0.2944	0.5578	0.1302	0.56	-0.0834	0.146	0.9148	-0.1529	1.6694	80.9695	-0.7505	18.7415
117	0.4152	0.4778	0.0189	0.6046	0.1084	0.1498	-0.1379	0.0371	-0.024	-0.0498	-0.1235	-0.2227	0.3405	0.2845	0.2668	0.8989	0.0226	0.3236	0.5979	0.3893	0.8871	88.3205	6.1159	16.6781
118	0.5439	-0.0775	1.1643	0.0602	-0.0791	2.6483	0.0483	0.1801	-0.3405	-0.1036	0.1224	-0.1407	-0.1039	0.5121	-0.2512	0.5027	-0.3161	-0.1179	0.6301	0.0062	0.3521	122.7114	170.5218	14.9726
119	0.4108	0.2365	-0.3533	1.2192	-0.5969	0.4494	0.1007	0.029	0.0436	0.3661	0.1538	0.1496	0.2655	-0.014	0.7845	0.5903	-0.1686	-0.0978	0.3869	-0.2428	0.5873	144.2879	163.6782	23.8433
120	0.0767	0.0488	0.0389	0.0288	0.0364	0.2103	-0.0789	-0.1867	0.1095	0.0785	-0.0122	0.0542	0.1865	-0.0658	-0.014	0.3278	0.0311	0.2291	0.6854	-0.1269	0.3706	148.1036	162.8095	20.1871
121	1.529	1.1151	-1.4377	1.5863	-1.1116	4.5242	0.0267	0.1132	-0.0222	0.1086	0.0023	0.1717	-0.0476	-0.1802	-0.0339	0.6666	-0.0729	0.4275	0.9166	0.0314	0.6409	154.4632	151.191	12.629
122	0.4107	0.4345	-0.3209	0.7094	0.2257	5.9733	-0.0143	0.0225	-0.331	0.1397	0.3428	0.0385	0.2172	0.7773	-0.0199	0.4628	-0.0716	0.3245	0.4136	-0.203	0.8517	162.8204	159.507	12.4611
123	0.3718	-0.1214	-0.2182	0.4603	-0.1656	0.2616	0.0108	0.0108	0.0905	0.0659	-0.0366	0.095	-0.0743	0.0027	0.1675	0.2264	-0.2098	-0.0365	0.2938	-0.0184	0.4488	156.715	180.1475	15.9858
124	0.9497	-1.2468	-0.2334	2.6121	0.9747	0.6351	-0.2641	-0.0803	0.2416	0.3571	0.0448	0.3368	-0.1313	0.0088	0.139	0.6858	0.1123	-0.0425	0.2116	0.1247	0.6128	87.8956	102.0797	-37.5942
125	0.1387	-0.1636	-0.0192	0.2447	-0.0211	0.1935	0.2594	0.0636	-0.071	-0.1474	-0.0783	0.1992	-0.1792	-0.1827	0.3778	0.2183	0.1258	-0.0781	0.0008	0.0298	0.606	74.1953	109.0763	-11.1034
126	0.0331	0.0406	0.0428	0.0529	0.051	0.0943	-0.1502	-0.0173	-0.1057	0.0798	0.0245	0.1438	0.0714	0.0085	-0.0055	0.3069	0.2562	0.0158	0.6687	-0.1397	0.8072	50.3214	108.7045	3.9159
127	0.6991	-0.27	0.6489	0.5926	0.0105	0.7413	0.31	0.2318	-0.7276	0.0337	0.1311	0.2135	0.3356	0.0614	-0.3368	0.6278	0.2298	-0.3921	0.7327	-0.459	1.3551	43.4411	111.5787	7.3769
128	0.3485	0.1277	-0.1073	6.0108	0.742	1.369	-0.1435	-0.2094	-0.0907	-0.0368	-0.2892	0.1721	-0.3378	-0.1953	0.2809	0.6736	0.2366	-0.2338	0.4625	0.0017	0.9256	46.683	107.1508	-10.3013
129	0.3054	0.3314	0.2044	0.4948	0.0046	0.5036	0.0418	-0.1595	0.0591	0.1266	-0.0159	0.1507	-0.1576	-0.1097	0.3591	0.6214	0.2815	0.2755	0.6223	-0.2252	0.7047	44.4648	104.2597	-18.5572
130	2.8119	-0.6308	-0.1433	2.0885	0.1551	2.2976	-0.0779	-0.4565	-0.2915	-0.5087	-0.0564	0.4287	0.0482	-0.3229	0.1775	0.4229	-0.0025	-0.0813	0.4387	0.0465	0.5845	43.2847	105.1241	-14.0593
131	1.4807	-0.0943	-0.1026	0.0589	-0.0524	0.0487	-0.0672	0.4452	0.078	-0.0767	0.2303	0.0928	0.0679	0.15	0.1234	0.4288	-0.1532	-0.2456	0.654	-0.0397	0.7051	65.0775	100.1385	-20.0011
132	0.1464	-0.0163	-0.1434	0.3622	0.2754	0.3332	0.1548	0.1214	0.1819	0.0474	0.1305	0.2904	-0.0412	-0.1183	0.3366	0.8501	0.4406	-0.1152	0.4631	0.0364	0.6383	98.4118	137.9823	-37.4656
133	0.937	0.2986	0.447	1.2417	-0.249	0.8807	0.0023	0.0262	-0.043	-0.0564	0.1066	-0.1621	-0.1933	0.157	0.2027	0.3451	-0.1424	0.0797	0.2563	0.1162	0.5392	101.5261	151.4321	-34.7487
134	0.6174	0.8585	0.0476	1.1901	0.0256	2.3112	0.0784	0.0831	0.2596	-0.228	-0.0509	0.2719	-0.244	-0.2191	-0.0695	0.476	0.177	0.0283	0.1646	0.0393	0.5784	100.9148	145.5027	-44.6044
135	0.5306	1.0792	0.5068	2.2266	0.9286	0.8076	-0.0838	0.1339	0.1422	-0.1498	0.1942	-0.0693	-0.0815	0.0619	0.0235	0.1424	-0.0916	-0.0674	0.1665	0.0584	0.3267	87.3937	149.1232	-51.8341
136	0.3198	0.093	-0.4291	0.0267	-0.1255	0.5739	0.1637	-0.2383	0.0007	0.1575	0.2329	-0.1465	0.2068	-0.0757	0.3307	0.3083	0.0702	-0.2098	0.3513	-0.1294	0.5668	91.2063	143.22	-40.1702
137	0.6513	0.0436	0.6549	0.367	-0.0016	0.8878	-0.0891	-0.0849	0.0965	0.0261	0.0455	0.0179	-0.1615	-0.0568	0.1462	0.4271	0.0746	0.0281	0.1878	-0.181	0.3053	114.772	122.4146	-37.7487
138	0.5479	-0.416	-0.0145	0.4868	-0.1161	0.0948	0.0001	0.1002	-0.0818	-0.1017	-0.0263	0.1207	0.0635	-0.2094	-0.0368	0.2684	-0.1191	-0.1454	0.3767	-0.1202	0.3229	125.0059	115.6653	-25.4235
139	1.5312	0.4822	-1.0358	2.0035	0.8355	1.4292	0.005	-0.0788	0.0361	0.1007	-0.048	-0.0743	0.0349	0.1076	-0.2188	0.5408	-0.0966	-0.3395	0.827	-0.0951	0.3543	113.0564	123.1932	-34.5016
140	3.3589	-2.403	0.8536	3.2321	-0.2134	0.6218	0.029	0.0495	-0.0916	0.1018	-0.0489	0.1831	0.0186	0.0812	0.1909	0.539	-0.0299	-0.3068	0.4115	-0.1344	0.5805	90.8104	142.509	-41.7929
141	3.0586	-0.7208	0.6528	5.4256	-0.603	1.6161	0.1922	0.2159	-0.0304	-0.4236	-0.2133	0.2541	-0.4783	-0.3202	0.07	0.5812	0.1613	0.1304	0.5168	0.0979	0.7354	143.7124	118.4062	-83.2531
142	0.3808	0.0448	0.067	0.1976	0.1055	0.1718	0.0016	0.0052	-0.0291	0.0483	0.0085	-0.0479	0.0116	-0.0011	-0.0942	0.214	0.1218	-0.1866	0.1711	-0.1542	0.3372	145.4461	136.7237	-73.0661
143	0.0001	-0.0096	0.0129	0.6287	-0.8249	1.0825	-0.2175	-0.0832	0.5066	0.3094	-0.2148	-0.4189	-0.4739	0.3013	0.3109	0.3651	-0.1897	-0.0768	0.7541	-0.2265	0.7167	146.927	129.4577	-76.2061
144	2.6848	0.633	2.1787	1.9569	1.0785	2.3772	0.1231	-0.2574	-0.0295	0.1525	-0.0711	0.0746	0.2075	-0.2191	-0.0941	0.5113	-0.3449	-0.1703	0.6351	-0.049	0.4653	151.3383	120.0584	-80.0932
145	0.518	0.2557	0.1879	0.5378	-0.1589	0.7268	0.255	-0.3754	0.1376	0.4378	-0.2028	0.378	0.175	-0.3901	-0.1959	0.415	-0.0275	0.2135	0.5022	0.2113	0.5156	153.2155	125.5752	-75.5834
146	1.3565	-0.4618	0.2019	2.7486	0.9214	3.914	0.3569	0.2339	0.0128	-0.3451	0.224	-0.3172	-0.1426	0.4286	-0.3406	0.5336	0.0112	-0.012	0.7465	-0.1221	0.1977	130.7419	121.772	-60.3123
147	1.089	0.5786	0.2427	0.6506	-0.0346	0.5475	-0.2982	0.2866	0.1783	-0.2537	0.0005	-0.0947	-0.7191	0.5121	0.3177	0.8364	-0.3125	-0.3329	0.4422	0.1745	0.4491	127.1034	117.5354	-61.7378
148	1.2341	0.2969	0.2521	1.7849	0.2353	0.32	0.2392	-0.0377	-0.1456	0.2026	-0.3529	0.4416	0.1938	-0.2139	-0.0179	0.5276	-0.1933	-0.2102	0.506	-0.1439	0.4918	148.8712	127.0221	-73.2356
149	0.5106	-0.1373	-1.2006	6.1621	3.3075	4.2764	0.0066	-0.2354	0.1645	0.316	0.7014	-1.1659	-0.0813	1.062	-0.7293	0.5699	-0.0288	0.071	0.587	-0.3797	0.6696	155.7253	135.9334	-84.4142
150	0.8289	0.2459	0.6077	3.6194	1.5262	0.956	-0.0495	0.1024	0.0469	-0.0637	0.0481	-0.1907	-0.1412	0.1499	0.0503	0.2622	-0.2061	-0.1356	0.3437	0.1909	0.2974	144.178	137.3703	-84.2399
151	3.1012	-1.7671	2.7546	2.7978	-1.1764	2.5349	0.3739	-0.2291	-1.5891	-0.3893	0.5916	0.0764	0.9527	-0.2258	-0.7938	1.1755	-0.1869	0.1367	0.3953	0.0275	0.8557	100.4692	107.6534	-88.3468
152	7.2757	-0.4991	3.6727	3.4067	3.9027	7.6037	0.0465	-0.1081	0.4516	-0.4718	-0.1354	0.2137	-0.8928	0.505	0.0746	1.1674	-0.1531	-0.3438	0.8211	-0.217	0.5522	85.4106	118.2162	-83.7278
153	0.1678	0.1474	-0.062	0.2986	-0.0749	0.1598	-0.0172	-0.0258	-0.0156	-0.0823	0.0767	0.1292	0.0142	-0.0871	-0.1804	0.3072	-0.2341	-0.1824	0.5129	0.3157	0.417	98.7389	116.3957	-85.6794
154	1.1647	-2.2197	-1.9571	7.4384	5.3718	4.1256	0.2102	0.5542	0.2162	0.0305	-0.1824	0.2946	-0.3352	-0.6348	0.0034	0.783	0.1188	0.0324	1.0143	-0.1093	0.451	95.1096	122.8253	-80.5109
155	0.743	0.4039	-0.0845	0.2236	-0.0347	0.0519	0.2251	-0.1924	0.0999	0.2536	-0.1737	0.151	-0.2768	0.1559	0.0829	0.6837	-0.0825	0.3268	0.5647	0.2786	0.6761	101.1552	132.0292	-76.5164
156	0.9741	0.2526	2.2254	0.1173	0.712	5.428	0.1641	0.0706	-0.3302	0.2321	-0.1497	-0.2396	0.9436	0.9706	-0.1072	1.3856	0.0063	-0.2688	1.3187	-0.0769	0.4233	86.6869	109.4278	-91.8027
157	5.8217	1.116	-2.6722	2.8094	-0.5775	2.2495	-0.1307	1.5809	0.0768	-1.2137	-0.5672	-0.4434	0.9068	0.015	0.5797	1.5788	-0.1585	0.0303	1.4101	0.298	0.4933	93.9311	101.4106	-99.7703
158	0.2478	0.2806	0.0948	0.4152	0.2107	0.1469	0.1828	-0.252	0.0414	0.8665	-0.1878	0.4527	0.0527	-0.1171	-0.0012	0.8251	-0.0811	0.3485	0.298	-0.1046	0.6148	63.7486	70.8076	45.46
159	0.7496	-0.1765	-0.5163	0.1944	0.1096	0.8124	-0.1642	-0.0085	-0.179	-0.0246	0.0114	0.068	0.2067	-0.0707	0.0575	0.2204	0.0188	0.2156	0.5532	0.0016	0.6598	67.3564	67.0634	49.2417
160	0.9259	0.6292	-0.4535	0.6027	0.0031	0.7607	0.0931	0.2649	0.2666	-0.1595	0.0269	-0.0941	-0.1978	-0.4045	-0.2625	0.6414	0.0089	0.4526	0.4017	0.026	0.6677	70.0734	64.7993	50.3853
161	0.5606	0.2276	0.0966	0.73	0.1486	0.663	-0.0534	-0.0569	-0.2966	0.0276	0.0425	0.2909	0.2771	-0.1641	-0.0931	0.6365	-0.2923	0.1729	0.5644	0.1886	0.7894	80.9661	59.1759	62.7495
162	0.1245	-0.126	-0.2523	1.1371	-1.2589	2.7944	-0.3913	-0.0505	0.1517	0.5183	-0.3188	-0.1457	-0.1914	0.4828	0.065	0.6697	0.1594	-0.1514	0.2657	0.0068	0.6018	90.0854	60.9063	67.0264
163	0.0278	-0.0033	-0.1975	0.0002	0.0217	1.3782	-0.1636	-0.0295	-0.1084	-0.1408	-0.4432	0.0644	0.4284	0.4366	0.5518	1.0513	0.1391	0.116	0.5209	0.3154	1.6187	84.5884	50.6559	64.9616
164	1.7318	2.9851	0.7729	7.3908	0.6795	0.9343	-0.1398	0.0554	0.0308	-0.5079	-0.1285	-0.0554	0.1306	0.0219	0.1304	0.8306	0.0829	0.1319	0.163	-0.0046	0.6854	108.6259	70.7743	58.837
165	4.4681	-0.1064	0.6906	2.6237	-1.936	1.7731	-0.406	0.5613	-1.2335	-0.0665	0.8829	-0.3877	0.2271	-0.0756	-0.4593	0.4216	0.0654	0.2882	0.6774	-0.0367	1.2049	117.6586	58.8012	32.497
166	0.0752	-0.1432	-0.1072	0.2745	0.2044	0.1513	-0.0631	-0.3481	0.1519	0.0712	-0.3759	0.0567	-0.0142	-0.0164	0.1915	0.3416	-0.1553	-0.088	0.3243	0.0568	0.3709	112.2594	61.9368	11.9647
167	1.9425	-1.3685	-1.261	1.4615	1.2651	3.2168	0.0118	0.0717	-0.0501	-0.0572	-0.0556	0.0482	0.2265	-0.1782	0.3611	0.4485	0.0045	0.0782	0.3433	-0.184	0.2597	88.6488	47.9733	6.543
168	0.2499	-0.171	0.0617	0.2926	-0.6756	2.2898	0.3613	-0.1193	-0.0457	-0.0939	0.2789	0.4322	0.3562	0.2541	-0.3024	0.7471	0.3167	0.153	0.4782	-0.0188	1.0712	87.3165	41.3457	4.0429
169	5.7898	-3.0283	1.6436	3.4247	-0.9144	4.3013	0.2776	0.1497	-0.1568	-0.0082	0.1425	-0.2611	0.2241	0.0736	-0.2678	1.0086	-0.1001	0.1402	0.3378	-0.1161	0.3825	90.0003	39.2514	15.8933
170	0.8865	0.5497	0.4184	1.2048	0.1156	0.7235	0.0171	-0.2781	-0.0874	0.3634	-0.0002	0.3862	0.1382	-0.2793	-0.1222	0.8854	-0.1345	0.4355	1.15	0.1606	0.6449	85.9832	32.2488	8.6487
171	2.3345	0.0999	-0.7589	0.0419	-0.2389	1.3612	-0.5094	-0.0815	0.3669	0.3054	0.5638	0.428	-0.2266	-0.2613	0.0042	0.5797	0.0117	0.1	0.3696	0.0143	1.4575	91.2262	35.9423	5.2426
172	0.0487	0.0514	0.0504	0.0893	0.0403	0.0604	0.0255	0.0889	0.0435	0.0579	0.1238	-0.0463	0.0156	0.067	-0.0547	0.7235	0.3076	0.119	0.9284	-0.0079	0.3181	81.1008	37.1892	17.0261
173	1.7926	1.6262	2.5642	1.6451	1.7625	5.5148	0.3985	-0.76	0.2868	0.4002	-0.5489	0.3043	0.8885	-0.9521	0.0872	1.0066	0.0733	0.6255	0.9062	0.3732	1.3403	79.5736	35.6528	10.6117
174	0.5017	-0.2465	-0.1634	1.8598	0.8917	1.5773	-0.1686	-0.1551	-0.1698	0.3865	0.1317	-0.2014	0.7224	0.0679	0.2598	0.5218	0.1912	-0.1265	0.3003	-0.1304	0.3079	141.047	55.1403	-35.9451
175	0.2249	-0.4971	-0.7639	1.1313	1.9028	3.51	0.5351	0.1539	0.4981	-0.2568	0.278	-0.8905	-0.1718	0.4598	-0.6761	0.7524	0.3201	-0.0232	0.5869	-0.1108	0.7883	162.2072	57.9807	-61.5212
176	0.4685	0.3382	-0.0586	2.2447	2.2308	3.1536	-0.084	0.2392	-0.1437	0.0304	-0.1061	0.0688	-0.1374	-0.1449	0.088	0.7259	-0.2042	-0.2303	0.4668	-0.1666	0.5134	129.4611	109.23	-101.0589
177	1.3201	-0.5759	0.8041	1.7653	-0.711	1.3768	0.1027	0.0945	-0.1435	0.1167	-0.1431	-0.2525	0.2225	0.3031	0.0829	0.4374	0.0933	-0.0652	0.4449	0.253	0.3329	139.9534	119.0314	-91.0519
178	0.3182	-0.2485	-0.0565	0.8115	0.55	0.4308	-0.1359	0.0472	0.0435	-0.1305	0.1843	0.159	-0.3213	-0.101	-0.1674	0.7051	-0.1116	0.0775	0.4345	0.1883	0.3268	132.8164	113.1361	-90.0987
179	0.8902	-2.2102	1.8228	6.7014	-3.5777	4.9588	-0.9787	1.3575	-0.0875	-0.9715	0.8596	1.306	0.4726	-0.7664	0.0692	0.7978	-0.2746	0.2373	2.3984	0.4446	1.9129	54.9641	73.9423	4.7279
180	0.6721	-0.4557	-0.1471	1.1773	0.2892	0.484	-0.0925	-0.0327	0.1462	0.0174	-0.0603	0.1051	-0.1742	-0.1845	-0.1134	0.3414	0.1955	-0.0688	0.1767	-0.1933	0.3938	68.9436	76.6448	0.7574
181	0.6517	0.4501	-0.7365	2.2975	-2.8238	3.5298	0.3237	-0.0736	0.1305	0.0189	0.0852	0.2758	0.1088	0.2843	-0.3137	1.5614	-0.336	0.0537	0.752	-0.4086	0.9982	54.9463	69.9437	2.629
182	5.3826	-4.2256	-3.0075	6.1033	4.3437	3.1181	-0.2397	-0.7292	0.0447	0.5387	0.2872	0.0643	0.4493	0.2474	0.0806	0.7382	0.255	0.2681	0.5071	0.0154	0.4374	63.4681	66.7345	8.7795
183	1.0279	1.1369	-2.2251	4.3923	-2.7973	4.8534	-0.4307	-0.258	1.1474	-0.0461	0.1179	0.0805	-0.2054	-0.4567	0.2635	0.3629	0.0438	-0.1623	0.7792	-0.0403	1.2842	57.1763	75.6728	9.1636
184	0.6201	1.9694	-0.9528	6.2521	-2.9023	3.5908	-0.544	-0.2142	-0.896	1.6087	0.0013	-0.9009	0.4555	0.9917	0.4223	1.4126	0.7899	0.396	1.6241	0.495	1.506	119.3847	-2.3085	48.1393
185	5.6013	-3.2456	-1.1707	4.5238	-0.4594	0.7678	-0.2031	-1.0708	-0.2711	0.6822	0.0571	-0.7185	0.9518	1.1902	0.0257	1.7034	0.8384	-0.0293	3.2775	-0.1189	2.1017	125.0312	3.7923	62.0911
186	5.7977	-0.0205	0.2426	4.295	0.1142	1.1801	-0.0426	0.1608	-0.2144	-0.2057	-0.0887	0.0333	0.4929	-0.3141	0.0879	2.2095	-0.8462	-0.8852	2.1167	-0.11	1.8465	137.1732	23.0772	89.8466
187	0.0358	0.0343	-0.015	0.1749	0.2603	0.5457	-0.0662	0.0259	-0.0482	-0.0505	-0.2154	0.0506	0.0342	0.1035	-0.2137	0.6725	0.0164	-0.051	0.1599	0.1064	0.5405	109.4494	116.2029	-14.5921
188	0.1798	-0.1787	-0.0616	0.7262	0.5207	0.4055	-0.079	0.1639	0.0686	-0.2	-0.1392	0.0233	-0.0702	0.0771	-0.1474	0.5459	-0.1257	-0.0683	0.4691	0.016	0.1259	98.423	128.454	-20
189	0.8255	0.2315	0.0038	1.8488	1.0312	1.5668	-0.1468	-0.0091	-0.0702	-0.0883	-0.0266	-0.0991	-0.435	0.2597	-0.0296	0.4172	0.0829	0.0836	0.5213	0.3383	0.3783	101.129	150.1967	-25.7107
190	1.7861	-0.9279	0.0138	4.8174	5.9161	9.7747	-0.3256	0.1182	-0.9703	0.8094	0.008	0.7508	1.6787	0.3381	0.3503	0.8177	0.1161	0.3442	0.6013	-0.2555	0.8587	102.2079	167.8804	-34.4817
191	0.0467	0.0108	0.0674	0.066	-0.0234	0.1224	0.0348	0.0563	-0.0135	-0.0753	-0.0453	0.0452	-0.0076	-0.0167	-0.0314	0.131	0.104	-0.0721	0.1693	-0.1036	0.1414	104.0184	160.7825	-30.2247
192	0.4321	-0.0168	1.5451	0.0008	-0.0613	5.5289	-0.0359	-0.0666	-0.1	-0.1182	0.3543	-0.2239	0.6225	0.2419	-0.2817	1.4949	0.1484	-0.1677	0.5442	-0.1037	0.736	109.5466	162.6424	-29.7292
193	0.6795	0.3949	0.1737	0.2336	0.1378	0.3475	-0.0495	-0.2197	0.1174	-0.0038	-0.0066	0.0096	-0.0997	-0.1378	0.1506	0.2169	0.0788	-0.2308	0.2458	-0.1173	0.396	109.5698	166.9107	-34.3215
194	3.545	2.4847	-3.1596	2.6063	-2.2355	2.8506	0.3317	-0.5074	0.5435	0.9873	-0.3666	0.6244	-0.8996	-0.6997	0.2659	0.5202	0.1647	-0.0735	0.4268	-0.2723	0.388	112.4846	171.7536	-31.6603
195	7.2335	5.1648	6.0862	6.2288	4.9857	5.282	-0.1708	-0.3239	0.2805	0.2295	0.0711	-0.2545	-0.3191	0.6875	0.1536	0.8071	-0.0005	-0.4222	1.1266	0.0186	0.5687	116.5583	166.1891	-39.8022
196	0.5097	0.363	0.2114	0.3728	0.0116	0.2617	0.1475	-0.1162	-0.1056	-0.0676	0.1276	-0.1576	-0.0043	-0.068	0.261	0.3497	-0.2901	0.2089	0.5699	-0.0318	0.7536	122.7716	25.9482	-2.136
197	0.5215	-0.1483	-0.2288	0.5502	0.1096	0.2579	0.0445	0.092	-0.1154	-0.469	0.05	-0.107	-0.0643	0.1275	0.1094	0.8069	0.2705	0.1039	0.5571	-0.2435	0.7204	116.2356	18.5835	-7.8273
198	0.1626	0.0617	0.2046	1.1005	1.0053	1.3754	-0.0448	-0.3887	0.3238	0.2862	0.0453	0.0102	-0.384	0.1397	0.0176	0.6633	-0.0346	-0.0039	0.5605	-0.1685	0.2063	144.1046	102.7752	-45.5188
199	0.8833	-0.3083	-0.1067	0.7857	0.1807	0.1423	0.0389	-0.0677	0.0643	0.3659	-0.1422	0.1248	0.0551	-0.041	0.0537	0.7554	-0.4035	-0.0124	0.5707	-0.0015	0.4277	133.1923	90.9387	-53.8458
200	2.1025	0.7986	0.9796	3.2585	-0.341	2.3012	0.0329	0.1736	0.0858	0.0961	-0.1489	-0.2801	-0.2145	0.0621	0.0529	0.5429	0.2235	-0.1465	0.4944	-0.0357	0.3332	135.4585	104.7508	-54.6144
201	0.5859	0.3237	0.0524	1.1906	0.2759	0.1973	0.0986	-0.3085	-0.2737	-0.0978	-0.0023	-0.253	0.0818	-0.109	-0.1019	0.4179	-0.194	-0.2199	0.3787	0.162	0.707	106.75	43.4456	-19.8639
202	2.2758	3.0853	2.4097	6.3705	5.6957	5.2479	0.0349	-0.3119	0.0335	-0.1353	-0.034	1.5086	-0.6478	-0.9969	0.0053	0.9975	0.4188	-0.0848	0.9222	0.07	0.5074	99.5656	42.6944	-18.3388
203	0.1486	-0.178	-0.0958	1.0676	0.4114	0.1645	0.1188	0.0014	-0.0601	-0.1515	-0.0123	0.0348	-0.1321	-0.0718	-0.0009	0.3012	-0.0743	-0.174	0.1116	0.1315	0.501	99.4376	54.3251	-27.8562
204	1.4585	-0.8807	0.1127	4.9745	-2.0998	1.182	0.0414	-0.0898	-0.0207	1.1263	-0.2326	1.0137	-0.4897	-0.5434	0.1601	0.6937	0.0139	0.0572	0.5052	-0.397	1.0769	95.9404	106.4128	52.6462
205	1.055	-0.6714	0.8711	1.4072	-0.9176	0.95	-0.138	-0.0101	0.0111	-0.1419	0.2064	0.1905	-0.1627	-0.1269	-0.1071	0.7388	0.1859	0.329	0.6171	0.4277	0.7325	97.5194	110.1956	51.2065
206	2.4483	0.5834	0.0927	1.0612	0.0818	3.6201	0.0205	1.0475	-0.4655	-0.4482	-0.2776	-0.017	0.3912	0.8415	-0.0182	0.7474	0.4306	-0.1905	0.9711	0.0448	0.6613	284.245	-69.3141	2.5536
207	1.7042	-0.7616	-0.4712	0.3479	0.1888	3.3443	-0.1463	-0.5973	0.0518	-0.1168	-0.1296	-0.2921	-0.458	0.0834	-0.2681	0.272	-0.0604	0.085	0.431	-0.0774	0.8401	245.8981	-47.4102	41.095
208	0.6552	-0.5457	0.0023	1.7573	-0.5998	0.8447	-0.0889	-0.4136	0.224	-0.2407	0.2131	-0.389	0.3277	0.0674	-0.0958	0.5699	-0.1252	0.1525	1.0759	-0.064	0.6257	255.203	-15.9499	60.9468
209	2.7543	1.0725	0.9269	0.7902	-0.6395	3.1039	0.0829	-0.4773	0.1836	0.2877	-0.361	0.6839	-0.3994	-0.2533	0.1506	0.5517	-0.141	0.3835	0.6355	-0.131	1.0027	227.756	-13.8498	44.9399
210	0.6897	-0.582	0.127	1.0645	-0.3684	1.4238	-0.1531	-0.2902	0.1854	-0.1008	0.2753	-0.1991	-0.0273	-0.17	-0.0604	0.5508	-0.1746	0.0211	0.6629	0.0034	0.6013	220.8713	-25.1283	26.4755
211	0.9909	0.982	0.3796	1.4438	-0.6147	2.2935	-0.0986	-0.3375	-0.1759	0.0949	-0.2511	0.6905	0.2502	-0.5693	0.2452	0.2735	-0.028	0.161	0.6687	0.023	0.9404	200.1903	-21.3423	44.0359
212	6.5572	1.7686	-1.0783	4.4135	0.8753	4.2115	1.0159	-1.4856	0.1341	0.2983	-0.5203	-0.0537	-0.7666	0.1785	-0.3207	1.3387	0.1646	0.3302	1.366	-0.4287	1.0143	187.9622	-12.1803	64.9698
213	0.0231	-0.1278	0.1563	0.6472	-0.7927	0.9726	0.3822	-0.1865	-0.5221	0.6043	-0.3913	0.9942	0.2583	-0.6266	0.0494	0.878	-0.4429	0.1736	1.2441	-0.263	1.0329	222.113	-34.0445	71.6786
214	0.8795	-0.3449	-0.7938	2.3616	0.4793	0.7272	-0.2301	0.0668	-0.3759	1.0093	-0.1254	0.021	0.0801	-0.1112	0.2655	0.6722	-0.1991	0.1422	1.1436	0.0888	0.5814	245.8847	-60.7763	64.3648
215	0.9544	-0.2877	0.4282	1.1839	0.1361	0.2613	0.1348	-0.5712	-0.213	0.631	0.2294	0.1943	0.2147	0.0281	-0.2768	0.4952	0.0183	0.119	0.7305	-0.0456	0.6557	194.1947	-14.8111	41.1402
216	0.5912	0.7115	0.1596	1.0012	0.1945	0.0457	0.3799	-0.4293	-0.1483	0.5893	-0.1446	0.0854	-0.084	-0.1659	0.0856	0.5566	-0.037	0.175	1.1342	0.2828	0.6633	195.6239	-17.374	39.697
217	1.2055	-0.2292	0.2981	1.0188	0.4313	1.0335	-0.1123	0.1975	0.1874	0.0893	-0.0377	0.179	-0.1792	-0.0953	0.1666	0.4136	0.1266	0.0197	0.7017	0.0418	0.2485	262.7812	-43.0727	37.8569
218	0.6402	-0.0074	0.0393	0.0915	0.1335	0.2003	-0.0327	-0.4258	0.0335	0.0593	-0.1859	0.0633	-0.4219	0.4135	-0.2012	0.3921	-0.1325	-0.1809	0.573	-0.0736	0.826	274.4722	-58.7123	36.099
219	0.1334	-0.142	-0.325	0.8563	1.2097	1.8432	-0.2218	-0.1416	0.1305	0.3555	-0.2266	-0.0294	0.212	-0.0455	-0.2445	0.4621	0.2914	-0.1269	0.6197	0.0594	0.4105	276.3673	-73.3984	0.9834
220	2.8366	-1.0872	-1.1341	6.5533	-0.9432	3.6166	-0.3971	-0.751	0.05	1.6205	-0.3018	0.3078	-0.4124	0.5669	0.5334	0.7369	0.0389	-0.0727	0.9238	-0.3241	0.638	272.3136	-82.5077	1.3948
221	0.033	0.0659	0.0689	0.1761	0.2974	0.3705	-0.0622	-0.0385	0.1199	0.0817	0.0871	-0.1277	0.0096	0.1558	-0.0449	0.4878	0.2039	-0.1121	0.4212	0.0805	0.555	242.6659	-56.6076	5.1285
222	1.4372	0.0105	1.5309	1.3892	0.5848	2.1848	-0.3906	-0.3094	0.4581	-0.2674	-0.1002	0.1841	-0.1056	-0.071	0.3049	0.4666	-0.0966	0.2586	0.548	0.2044	1.0528	208.9375	-60.2299	40.5692
223	0.961	-0.3887	0.4273	0.5079	-0.3024	0.2361	-0.048	-0.0652	-0.0514	-0.0353	0.0117	0.4795	-0.3574	-0.384	-0.0811	0.4616	0.2815	0.006	0.4006	0.0085	0.5282	183.3073	-53.2853	14.5307
224	4.3209	2.7322	5.0564	3.4884	4.5266	6.9197	0.7669	0.2113	-0.9544	-0.2749	-0.0864	0.3752	1.3032	-0.6509	-0.8811	0.6806	0.0671	-0.3386	1.1706	0.0172	0.6132	172.4312	-54.6614	1.2951
225	2.8454	1.8231	-2.9688	4.1475	-4.1382	5.3702	-0.0773	-0.0128	-0.5193	-0.0281	-0.2317	0.3405	0.3777	-0.568	0.2861	0.5824	-0.1469	0.2526	0.8126	-0.33	1.7211	186.5008	-62.4244	6.1893
226	2.7532	-3.0054	0.6369	5.3967	0.4224	0.9539	-0.2288	0.0127	-0.9462	-0.8024	0.2791	0.9299	1.6172	-0.6612	-0.0963	3.0414	-0.5706	-0.489	3.4976	-0.0835	3.3657	195.8485	-87.2873	22.9778
227	0.2968	0.2762	-0.0283	0.8683	0.1529	0.2405	-0.1496	0.1031	0.1052	-0.1779	0.1455	0.423	-0.0814	0.0052	0.0023	0.3883	-0.0191	-0.0948	0.501	0.0725	0.5297	233.4965	-32.5733	-12.4534
228	1.132	-0.2695	0.2041	0.9712	-0.6586	0.4781	0.0809	0.2913	-0.4729	-0.3651	0.1642	-0.3205	0.1897	0.0332	-0.1913	0.7905	-0.1171	-0.1414	0.4622	-0.108	0.7721	250.6029	-77.078	-40.3945
229	1.9742	1.2556	-1.1898	2.4325	0.7868	4.1781	-0.834	2.5806	0.8596	-1.8889	1.3614	1.3508	-1.201	-0.8292	-0.1381	2.1607	-0.906	-0.401	3.1095	0.5659	1.838	249.0169	-56.2268	-88.9704
230	0.5847	0.0844	-0.3899	0.2091	-0.177	1.4123	-0.0177	-0.0355	-0.2038	0.0391	0.1299	0.0675	0.3958	-0.4057	-0.0841	0.5044	0.0199	-0.0897	0.4062	0.1388	0.6277	243.6901	-81.1388	-3.1769
231	0.251	-0.0349	0.1074	0.4606	0.0091	0.2604	0.0004	-0.2091	-0.0623	0.123	-0.0662	0.1226	0.1242	0.128	0.059	0.4386	-0.0127	0.099	0.5867	-0.0194	0.4103	270.1956	-22.3566	29.2108
232	2.5208	-1.4758	-0.2716	0.7128	0.1819	0.8757	0.0809	-0.4061	0.1293	-0.0636	-0.1758	-0.0916	-0.4021	0.0727	0.0374	0.8073	-0.2928	0.0839	0.7338	-0.2221	0.8336	281.3538	30.5654	31.4799
233	0.3023	-0.0224	-0.0426	0.3153	-0.0256	0.1033	0.0104	-0.0614	0.0897	-0.0402	0.0377	0.0831	-0.0561	-0.0304	-0.0516	0.459	-0.0109	-0.0312	0.5411	-0.031	0.3979	258.9553	3.0597	-4.8799
234	0.3849	0.5446	0.102	0.6897	0.3332	1.1642	0.1124	-0.068	-0.0949	0.2341	-0.3796	1.1282	-0.3578	-0.8511	-0.4679	0.6354	0.1358	0.2265	0.7874	-0.086	1.1387	201.41	-1.461	4.829
235	4.3779	-0.4585	0.1189	3.2385	-0.3465	3.3311	0.8655	1.2098	0.3051	-1.0259	-0.6067	2.9729	-0.1894	-2.562	-0.2522	2.3019	0.6056	-0.2655	3.0248	-0.1807	3.6733	166.0994	28.7308	14.6399
236	0.3333	-0.0048	-0.1171	0.1466	-0.0018	0.1704	-0.0122	0.0344	-0.0486	-0.0819	0.0087	0.1361	0.0387	-0.0701	0.0366	0.4589	0.0101	-0.0994	0.4508	-0.0322	0.5819	244.2798	-35.7281	-30.0746
237	5.4026	1.7609	-1.1728	2.9612	-1.5928	0.8908	0.199	-0.9582	-0.395	0.7019	-0.1235	-0.0539	0.1597	-0.3295	-0.0116	1.261	0.3842	-0.2082	1.4098	-0.2433	0.5283	308.2041	-72.153	-0.6594
238	0.4651	-0.2093	-0.2219	0.5067	0.4249	0.3547	-0.0395	-0.2919	-0.2523	-0.0207	-0.1314	0.2072	0.2181	0.3427	-0.1697	0.4425	0.0339	-0.2298	0.5413	0.187	0.6791	312.4311	-40.7645	-8.661
239	1.3533	-0.1441	-0.5044	0.0827	-0.0978	0.9879	0.1191	-0.2063	0.1368	-0.1523	0.096	0.2473	0.0827	0.0622	-0.2343	0.3956	0.027	-0.144	0.7307	0.0881	0.4497	319.977	-21.3113	-10.9813
240	0.2468	0.1428	0.1433	0.3731	-0.2835	0.5761	-0.0481	0.2477	-0.4546	-0.1794	0.018	0.2119	0.4573	-0.3142	0.0545	1.0134	-0.3499	-0.1707	0.463	-0.3169	0.9765	177.1251	-74.7065	-54.8352
241	0.0552	-0.0938	0.0103	0.2457	-0.0705	0.0537	0.1301	-0.3202	-0.679	-0.7158	-0.3372	0.9123	-0.0571	-0.3261	0.1597	0.811	0.0056	-0.3011	1.3717	-0.1708	1.415	163.2238	-61.7844	-60.0181
242	0.5605	-0.5659	0.3564	1.0651	0.3122	1.5318	-0.0673	0.4069	0.3528	0.7158	-0.0791	0.4299	0.006	0.4481	0.1392	0.9183	-0.1764	-0.3288	0.5753	-0.0575	1.0219	217.3021	-74.9966	-48.7603
243	9.5504	-0.6054	1.1475	2.0534	-1.3224	0.9128	-0.0082	1.6989	-1.3064	-0.6317	-0.0378	0.8907	0.4807	-0.3796	-0.2306	0.3625	0.1027	-0.1437	1.2234	-0.1944	1.0559	166.4378	-83.3333	-50.0234
244	1.5048	0.3394	-1.5721	0.1477	-0.4802	1.8543	0.3371	-0.454	0.2856	0.1427	-0.005	0.0668	-0.3233	0.2403	0.3822	0.5046	-0.1265	-0.2429	0.4575	0.0384	0.5131	248.8544	24.2685	8.8038
245	0.4639	-0.1318	-0.1782	0.0596	-0.0379	1.1138	0.0978	0.0842	0.1305	0.2541	-0.1168	-0.1565	-0.4524	-0.124	0.0954	0.3016	-0.1456	-0.0049	0.3026	-0.0971	0.5659	233.9824	32.8423	11.3877
246	0.2849	0.02	-0.2144	0.143	-0.2979	0.7292	-0.0631	0.0332	-0.1137	-0.0387	-0.1591	0.0032	0.2195	0.1574	-0.6015	0.304	0.1952	0.1977	0.4568	-0.0811	0.3741	221.1091	15.2404	1.7353
247	0.043	-0.0973	-0.0249	0.2101	0.0596	0.0178	0.0694	-0.0456	-0.0039	-0.0698	0.0283	-0.1281	0.1398	-0.0112	0.1461	0.2886	-0.0776	-0.0766	0.0414	0.0021	0.111	313.3633	-32.3741	-39.9454
248	0.3497	-0.0038	0.2211	0.3045	-0.2366	0.706	-0.0458	0.0796	0.3064	0.1814	-0.1139	-0.0611	0.0293	0.0493	-0.1826	0.3807	-0.0487	-0.2572	0.4998	-0.1165	0.3902	315.7205	-52.8367	-30.6198
249	1.0185	0.2463	-0.3586	0.9129	0.2728	1.7334	-0.0711	-0.1363	0.0319	0.2088	0.1278	-0.1195	0.1091	0.5912	-0.0529	0.4197	0.0341	0.142	0.5915	-0.0648	0.1974	318.0863	-53.8632	-32.6458
250	0.1453	-0.1062	0.1174	0.3366	0.0581	0.1729	0.0096	-0.1989	-0.0428	0.2157	0.046	0.1867	-0.0669	-0.1215	-0.0831	0.2268	-0.0611	0.1327	0.4823	0.1254	0.1832	296.5764	-36.5523	-27.859
251	1.8073	0.5475	-0.4541	0.8241	-0.1331	2.1763	-0.2786	0.1115	-0.7467	0.1514	0.1823	0.25	0.5721	0.1985	0.0573	0.4292	-0.0097	-0.0634	0.2646	0.0372	0.528	277.0911	-33.5249	-22.1446
252	0.0931	0.1199	0.0734	0.1749	0.2001	0.651	0.0861	0.1828	-0.0814	0.0084	0.0942	-0.0707	0.0951	0.1426	0.1115	0.4373	0.1256	-0.1576	0.6582	0.0391	0.2075	310.1201	-39.5449	-37.2568
253	0.9395	1.3278	-0.9759	2.3178	-1.6851	1.2764	0.0381	-0.0366	-0.1105	-0.1265	-0.1104	-0.0669	-0.1359	-0.058	-0.0448	0.563	0.2547	-0.1559	0.7487	-0.1125	0.2736	218.348	-78.4097	46.7759
254	0.1806	-0.3831	0.2486	0.8156	-0.4323	0.9056	0.0893	-0.3694	-0.1121	0.32	-0.2374	0.1639	0.1794	-0.1362	-0.1594	0.3845	-0.0792	0.265	0.5804	0.1503	0.4165	244.417	-38.0932	19.2307
255	0.1593	-0.0356	0.3313	0.5362	0.1404	0.7669	-0.1656	-0.1111	-0.1743	-0.1463	-0.0924	0.0238	0.0195	0.2388	-0.5671	0.1969	0.0676	0.125	0.4836	-0.1734	0.2753	221.9288	-68.3424	39.9108
256	0.5186	0.1286	0.2436	0.0354	0.0628	0.1155	0.0208	-0.0449	-0.25	0.089	0.107	0.0341	-0.1794	0.1867	0.219	0.4288	-0.2207	0.1989	0.9148	0.178	0.6213	227.9788	-77.416	65.2942
257	2.2661	0.3184	2.127	0.9536	0.161	2.888	0.1657	-0.1361	0.0233	0.4361	0.2074	-0.3597	0.2855	0.5834	-0.1626	0.7475	-0.0038	0.011	0.8369	-0.352	0.3759	227.6533	-71.377	55.5079
258	0.0784	-0.0375	0.1056	0.3584	0.3766	0.6766	-0.0497	-0.0239	0.0808	0.1199	-0.1274	-0.2704	-0.1389	0.1466	-0.0533	0.2442	-0.1824	-0.1145	0.5301	-0.0857	0.5388	217.35	-76.2685	54.1417
259	4.268	2.8753	1.8189	2.7083	2.3263	5.1714	-0.2736	-0.8305	0.5107	0.6047	-0.2445	-0.6713	-0.8275	0.0622	0.3944	1.1926	0.049	-0.3406	0.9886	-0.2161	1.4691	162.1413	-42.8891	-69.957
260	2.2792	1.5764	0.466	6.2595	4.3314	3.2043	-0.0963	-0.0341	0.754	-0.2801	-1.0847	1.298	-0.5349	0.0101	0.7538	0.9341	-0.1323	0.1056	0.7759	0.2585	1.1317	169.7673	-34.1773	-57.0566
261	1.1607	1.0393	-0.9743	1.4912	-1.2503	1.1089	0.2938	0.4112	0.0311	0.1719	0.1294	0.3073	0.0508	-0.2259	-0.2977	1.9028	-0.0662	-0.6748	1.9406	0.8579	1.6121	163.094	-31.0366	-77.0723
262	0.2095	0.2125	0.0339	0.2799	0.0701	0.0235	-0.0156	0.4275	-0.0745	0.2472	0.3854	-0.3581	0.0592	0.5559	-0.4208	1.609	-0.1486	-0.8352	1.4938	0.1443	1.742	167.8821	-35.7897	-73.475
263	0.9022	0.0917	0.5513	0.3262	0.217	0.7161	-0.0132	0.0773	-0.5115	-0.0371	0.4253	0.004	-0.1843	-0.1908	-0.2278	0.9092	-0.368	-0.0807	0.5734	0.2444	1.0375	278.5153	-85.7171	-78.7103
264	2.1674	0.4523	1.508	1.9226	0.336	1.0495	0.1243	0.035	0.0675	-0.0439	0.25	0.5393	0.2037	-0.1611	-0.2315	0.5229	-0.3697	-0.014	0.9189	-0.1882	0.9598	285.1115	-81.4981	-70.9163
265	1.3429	0.216	0.3122	1.6745	-0.4699	1.0178	-0.0417	-0.0153	-0.0243	0.0817	-0.0042	-0.0326	0.0545	0.0636	0.1054	0.9001	0.3808	0.3281	0.8791	-0.3199	1.0154	271.4912	-88.2224	-72.0583
266	0.3571	-0.29	-0.1239	1.0524	0.8359	1.4925	0.021	0.0306	-0.0104	0.0343	-0.0144	-0.0046	0.0531	-0.0399	0.011	0.6147	-0.121	0.1679	0.5218	-0.3378	0.3904	277.367	-78.653	-77.0255
267	0.3501	0.0302	0.1628	0.5005	0.1186	1.0087	0.0323	-0.0842	0.095	0.2241	-0.068	-0.1996	0.1785	0.0727	-0.2672	0.3941	0.0764	-0.2335	0.5305	-0.2791	0.5309	289.9586	-54.2799	-84.771
268	0.8247	0.0789	0.8901	7.4102	2.7416	2.782	-0.3006	1.1492	-0.1457	-0.2107	0.3151	-0.228	0.3117	0.2216	-0.1223	0.5205	-0.2614	0.1877	0.8954	-0.083	0.9177	293.3231	-53.9699	-80.3763
269	4.5247	-0.9487	3.6102	1.3883	0.0069	3.3711	-0.1986	0.5666	1.0281	-0.1483	-0.1617	-0.37	-0.3499	0.3656	0.4634	0.44	0.0691	-0.3137	0.74	0.2385	0.8761	286.9651	-67.4834	-78.8616
270	5.3992	-3.9084	0.7076	3.119	0.3891	2.8951	-0.1685	-0.2061	0.2987	0.3671	0.0842	-0.0366	-0.1569	-0.052	0.042	0.8227	0.0605	0.0963	0.2966	-0.1796	0.6211	283.8955	-56.4499	-76.0509
271	1.5316	0.1931	0.986	1.4061	-0.8527	1.3251	0.0654	-0.4574	-0.2534	0.2276	0.4854	0.7275	-0.0606	-0.8814	-0.4107	0.7491	0.2772	-0.096	0.9867	0.4255	0.8194	277.9858	-43.8322	-82.8013
272	0.3438	0.5729	-0.0549	3.8892	-0.8232	0.2364	-0.0239	0.034	0.0353	-0.0007	-0.0247	0.0451	-0.0256	0.0251	-0.1872	0.5221	-0.4105	0.1027	0.5441	-0.0486	0.2729	274.296	-47.7381	-85.4974
273	0.071	0.0489	0.0216	0.0395	-0.0099	0.1144	-0.0154	0.0781	-0.0375	-0.0874	0.0122	-0.1027	0.0343	0.0751	-0.2217	0.6979	0.1984	0.53	1.0891	-0.1553	0.8534	189.1136	22.9629	39.7121
274	0.0812	0.0802	0.0738	0.0801	0.0656	0.2123	-0.0162	-0.0275	0.0112	-0.0052	0.0142	0.0403	-0.0532	0.0215	0.1039	1.1462	0.2003	0.2212	0.8096	-0.4538	0.7971	197.9014	19.7056	37.9783
275	4.0857	3.3489	3.4698	6.356	6.3825	6.4139	-0.4869	-0.4996	0.5794	-1.0515	-0.067	0.0349	-1.4035	0.3854	0.5061	1.2356	-0.3548	-0.2432	1.2588	0.0529	0.4754	188.3389	14.1668	52.6831
276	9.2836	-2.1684	4.2969	4.4769	-4.8378	5.6915	0.0645	-2.6984	0.5817	2.5813	0.242	2.2875	-0.312	-1.3143	-0.3304	1.5851	-0.5029	0.8837	1.7819	-0.1665	1.8138	180.4237	23.627	60.1408
277	6.3294	3.621	5.4649	3.2725	2.5764	4.9705	0.7029	-0.2865	-1.5444	0.8843	-0.2006	-1.637	0.3968	2.2278	-0.5034	2.686	0.4571	-0.6161	2.8751	0.2453	3.0838	175.9972	29.7806	64.4084
278	0.9297	-0.0636	-0.3783	0.0087	0.0324	0.1571	-0.027	-0.3154	-0.1615	0.0207	-0.0514	-0.0424	0.2123	0.2344	-0.0653	0.6903	0.2356	-0.3794	0.8211	0.178	0.906	279.6318	-91.2136	-22.0749
279	0.2153	-0.0023	-0.1261	0.1808	0.1212	0.1673	0.0636	-0.1641	0.261	-0.2153	0.034	-0.1482	-0.0803	0.0125	0.0641	0.3943	0.2934	0.1761	0.4692	0.0611	0.5908	274.4603	-86.3583	-27.4216
280	6.2679	0.8595	-0.8307	3.7601	-3.5112	5.7259	0.3875	0.0434	-0.3073	0.3041	0.1294	-0.069	-0.0702	-0.3083	-0.3383	0.259	0.1347	-0.0713	0.4418	-0.0537	0.1745	285.2899	-82.2077	-38.4094
281	-0.0019	-0.0105	0.0086	0.2272	-0.1753	0.1362	-0.0113	-0.0405	-0.1358	0.0035	-0.073	0.0503	0.0226	-0.0879	-0.1036	0.2956	-0.1935	-0.0637	0.1934	-0.0675	0.3914	274.9963	-64.576	-41.5991
282	1.2178	-0.4358	-0.0591	1.7062	0.1093	0.6368	0.0019	0.1498	-0.0498	-0.1234	-0.0328	-0.0277	0.091	0.056	0.032	0.6697	-0.014	-0.0162	0.4703	-0.2588	0.3357	279.0498	-62.247	-42.4251
283	0.2973	-0.3306	0.1362	0.587	-0.1436	0.0619	0.0448	0.0534	0.0634	-0.0322	-0.0507	-0.0884	-0.0077	0.0114	-0.1249	0.7366	0.177	0.0893	0.1485	0.0529	0.1897	279.5654	-72.8189	-34.3163
284	1.2129	0.1363	1.6351	0.3982	-0.6977	4.232	0.0951	0.3293	-0.2005	-0.138	0.0369	-0.1956	0.4516	0.8972	-0.5024	0.3612	0.2114	-0.1725	0.7638	-0.189	0.3416	285.683	-79.7398	-28.4083
285	2.1673	0.3488	1.1675	0.1483	-0.1831	3.0199	0.0303	-0.202	0.1137	0.0707	-0.0683	-0.0238	-0.1548	0.3223	-0.2408	0.2664	-0.2427	0.0789	0.5	-0.1435	0.1826	287.7815	-92.281	-32.8088
286	0.0735	0.1625	-0.1727	1.0049	-0.7994	0.6759	0.028	-0.0905	0.4124	0.1991	-0.0505	-0.059	-0.1888	0.0942	0.2473	0.5307	-0.3125	0.0557	0.4256	-0.0806	0.4933	285.92	-2.4551	-45.3132
287	5.8414	2.2094	-0.2214	4.4391	0.8115	1.2259	0.0936	-0.0827	-0.2811	0.3389	0.298	0.0606	0.5916	-0.2923	-0.2456	0.6587	-0.1018	0.2084	0.6064	-0.0525	0.3711	285.7579	-15.4414	-47.5718
288	0.0727	0.1964	-0.0446	1.0202	0.0281	0.1021	-0.0649	-0.0552	-0.0251	0.0821	0.0089	-0.0534	-0.0306	-0.0062	-0.1781	0.4537	0.1528	0.1096	0.1386	0.0032	0.2092	279.2065	2.5423	-51.6204
289	0.8926	-0.1885	-0.4682	0.0422	0.0901	0.2582	-0.082	-0.4969	0.1764	0.1104	0.107	-0.0982	0.1297	0.2794	-0.1	0.3198	0.2369	-0.0254	0.5551	-0.243	0.4967	296.5672	-8.4241	-46.8114
290	1.0436	-0.3707	1.3366	1.3127	-0.4418	2.1312	-0.034	0.0055	-0.0057	0.1945	0.0091	-0.2196	-0.1817	0.134	0.4594	0.3966	-0.1483	-0.3151	0.2916	0.2126	0.5962	291.4473	0.4873	-58.5084
291	0.1464	0.0026	0.084	0.0005	0.0019	0.0486	0.0531	-0.2863	-0.0853	0.2126	-0.1461	-0.0004	0.0157	-0.0105	-0.0139	0.6086	-0.0067	0.1539	0.5822	0.1024	0.2312	300.3484	-10.4357	-53.9734
292	6.6024	1.5832	0.4226	1.8601	-0.7728	0.5426	-0.3222	0.6529	-0.0484	-0.4076	0.1155	-0.137	0.0825	0.1011	0.025	0.5863	0.1001	0.1526	0.5485	0.2368	0.4117	299.6005	-4.0516	-57.0887
293	0.0953	-0.0544	0.0194	0.4064	-0.3271	0.258	0.2197	0.033	-0.2621	-0.0285	0.0562	0.1434	0.1991	-0.1372	-0.0768	0.2284	-0.1402	-0.0714	0.6312	-0.1185	0.3723	228.5718	-72.4704	27.1891
294	1.9425	-0.9586	0.9878	0.4792	-0.5336	0.8558	-0.1385	-0.0457	-0.042	0.025	-0.1549	0.1267	0.1663	-0.3921	0.1139	0.2396	0.0637	0.001	0.3323	-0.1256	0.3254	224.4225	-50.1865	4.5014
295	4.0111	-0.6261	1.1472	0.9941	-0.192	0.328	0.1046	-0.7435	1.1146	1.0994	-0.1123	0.2992	-1.3348	-0.3243	-0.0224	0.8274	0.0902	0.052	0.4308	-0.1891	0.8574	195.0294	-39.553	7.7987
296	0.1135	0.1535	-0.1575	0.7882	0.2998	0.6724	-0.3116	-0.094	0.1237	0.3203	0.4283	0.5777	0.1228	-0.2216	-0.2801	0.3685	-0.0374	0.2947	1.0987	-0.1659	0.8825	187.5547	-40.5571	25.7594
297	1.1035	1.1997	0.0292	6.4641	2.7768	1.4602	0.1113	-0.2195	-0.2188	1.1887	-0.4971	-0.2924	0.2313	0.0494	0.0996	0.6622	-0.0479	-0.3743	0.3183	0.0244	1.1588	184.2072	-64.4314	34.4201
298	1.2801	0.6596	0.0476	0.8399	0.0792	0.4707	0.0281	-0.2946	0.3064	0.0485	-0.052	-0.0289	-0.0876	0.0709	0.1048	0.047	0.0207	-0.044	0.1909	-0.0099	0.2649	185.9039	-59.5302	30.5002
299	0.6166	0.1887	-0.0428	0.4737	-0.1816	0.1844	-0.063	-0.0778	0.0821	0.0216	0.0739	0.0368	0.0165	0.0585	-0.2642	0.5847	-0.0626	0.5081	1.1896	0.0508	0.8885	174.3187	-61.8664	31.0955
300	0.7233	0.1686	-0.0512	0.7144	-0.3973	1.1455	-0.3749	0.0326	0.0143	-0.237	0.0364	-0.075	0.2343	-0.1202	0.0078	0.2131	-0.0794	0.0742	0.3462	0.0891	0.6019	222.2784	-53.3165	-55.9669
301	0.6159	-0.413	0.7516	1.1872	-1.5648	2.1529	0.0204	0.0244	0.0119	0.0705	0.0636	-0.0432	0.2515	0.062	0.1267	0.3089	0.102	-0.0251	0.2826	0.258	0.3967	229.9711	-46.5342	-57.9021
302	1.1022	-0.373	0.3947	0.8106	-0.1083	0.1421	-0.4608	0.5981	-0.0664	-1.2529	0.5283	0.1754	0.0949	-0.1646	-0.0916	0.7082	-0.2997	-0.1829	0.3985	0.1199	0.4801	232.3261	-45.2046	-74.773
303	1.4498	0.5606	-0.2268	0.4982	-0.2445	0.1221	0.2099	-0.0238	-0.09	0.0831	0.1663	-0.0635	0.297	0.0807	-0.0682	0.2669	0.021	-0.1507	0.803	-0.0571	0.3102	225.6117	-45.9633	-55.1108
304	0.1549	0.3644	0.1054	1.3904	0.8179	0.6813	0.1291	0.3168	0.0768	-0.6645	-0.0744	0.0968	-0.3367	-0.1879	0.0934	0.9092	0.373	-0.0724	0.5586	-0.0417	0.3584	228.1118	-38.1887	-35.4421
305	2.0857	0.056	0.5219	2.4513	0.6591	0.4395	-0.0228	0.451	-0.0974	-0.6314	0.0532	0.2779	-0.075	-0.0221	-0.1677	0.474	-0.018	-0.312	0.8335	0.0009	0.4727	226.063	-53.8145	-61.5817
306	1.6328	-0.1684	0.1083	0.463	-0.0759	0.0746	0.0757	0.2578	-0.1237	-0.0692	0.0123	0.0132	0.0287	-0.0511	-0.0227	0.0998	0.0622	-0.0492	0.5129	0.0479	0.2469	236.7536	-55.5865	-68.2399
307	0.4743	0.4115	0.1339	0.3527	0.1156	0.0376	-0.0515	0.1553	-0.0797	-0.3154	-0.0104	0.155	-0.0239	-0.0885	0.1559	0.3566	-0.0433	-0.0783	0.1045	-0.0343	0.1371	224.1033	-67.8867	-70.8668
308	4.1158	-0.7682	-4.0736	0.5404	0.4196	4.3235	0.36	0.3076	0.1501	-0.3193	0.3278	0.29	-0.5456	0.2362	-0.6124	0.8258	0.0294	0.1598	0.8793	-0.0888	0.8117	304.0473	-27.476	-10.8588
309	0.5187	0.5315	0.0649	0.9378	-0.03	0.0339	0.0586	-0.0299	0.0753	-0.0347	0.0477	0.1913	-0.0212	0.0325	0.1662	0.4842	-0.302	0.1217	0.372	-0.1469	0.3814	307.7775	-17.6269	4.297
310	0.1348	-0.1363	-0.0583	0.1658	0.1247	0.1694	0.0336	0.006	0.0086	-0.1061	-0.0237	0.0127	-0.1217	-0.0596	0.1529	0.3147	0.1773	-0.0831	0.1192	-0.1113	0.0951	313.7751	-25.1916	5.2902
311	0.0381	-0.0021	-0.025	0.0451	0.0271	0.0308	0.0276	0.0332	0.0303	-0.0425	-0.0433	0.0066	-0.082	0.0003	-0.0899	0.4862	0.3731	-0.0238	0.5396	-0.0638	0.1389	323.0973	-9.9923	0.4046
312	0.0526	0.1553	-0.1037	1.595	-0.4231	0.2126	0.0415	-0.0676	0.0014	0.0869	-0.0893	-0.1628	-0.0414	0.0577	-0.0086	0.5029	-0.2446	0.0077	0.2611	0.0432	0.205	322.192	-9.4362	10.1059
313	3.9369	-0.537	1.1501	0.4278	-0.6568	1.0406	0.0566	-0.1074	1.6428	-0.0172	-0.0862	-0.307	-0.6304	-0.2485	-0.081	0.6233	0.1499	0.1898	0.6436	0.2781	1.0242	330.8427	-19.8883	6.5184
314	0.2417	-0.2347	-0.1341	0.3281	0.398	0.7928	0.346	-0.593	-0.1161	0.2762	-0.3179	-0.0642	-0.0135	-0.1518	-0.0072	0.4126	-0.0553	-0.2273	0.4281	-0.0883	0.4287	320.667	-30.2815	4.3883
315	3.1137	-1.7815	0.3573	1.7111	-0.5888	0.2835	0.1729	-0.0077	0.2209	0.0996	0.0615	0.0591	-0.1787	-0.0972	-0.1414	0.5705	-0.3498	0.1527	0.8527	-0.0316	0.3884	301.8731	-35.632	13.1437
316	0.3628	0.0818	-0.386	1.0544	0.7855	3.5451	-0.0508	-0.2782	0.0088	0.0919	0.0131	-0.1022	0.2258	0.4891	-0.1776	0.2424	0.159	-0.0158	0.4739	-0.0862	0.1405	319.0033	-29.3441	9.9167
317	1.3344	0.0591	-0.0792	0.9911	-0.533	0.2883	-0.3565	0.4256	-0.1121	-0.5302	0.3581	-0.1608	0.5191	-0.2633	0.0984	1.063	-0.1819	0.4208	0.6498	0.2432	1.1392	173.4026	-58.6198	-48.8925
318	0.9003	-1.044	-0.5654	3.9261	0.2274	1.324	-0.3004	-0.0216	-0.0912	-0.1668	-0.0814	0.518	0.0809	-0.0508	0.2125	0.6545	0.2163	-0.2387	0.3823	-0.1564	1.1268	166.0131	-67.1021	-39.6217
319	0.5688	0.0389	-0.1574	0.1222	-0.2039	0.3601	0.0405	0.008	0.1136	0.1267	0.0835	0.0061	0.0324	-0.2681	0.2145	0.715	0.095	0.2454	0.6717	-0.2821	0.42	157.339	-74.2695	-42.5161
320	3.4643	-5.0923	1.2961	7.9288	-0.5474	4.6322	0.37	0.3192	-0.872	-0.5173	-0.1261	1.2688	0.2558	-0.5073	-0.2256	0.4574	0.1783	0.0807	0.3823	-0.141	0.6898	148.6506	-67.3886	-39.8444
321	6.4457	1.5592	1.5396	1.5488	1.8432	2.2696	-0.2549	0.3543	0.07	-0.2726	-0.06	0.3947	0.1755	-0.3067	0.1545	0.485	-0.3445	-0.1846	0.7109	0.0222	0.9704	160.2575	-70.3441	-33.2344
322	0.2037	-0.0314	-0.0423	0.2797	-0.0979	0.1438	-0.0112	-0.0143	0.079	0.0371	0.0193	-0.0043	-0.0556	0.0302	-0.0267	1.051	0.0062	0.0062	0.5689	-0.4515	0.6019	155.2496	-62.6257	-35.1095
323	0.5544	0.7786	0.6636	1.7021	0.6583	2.4091	0.0391	0.0029	-0.0135	0.0841	-0.0067	-0.0407	0.0717	0.1716	-0.1084	0.2228	0.0361	-0.0713	0.3841	-0.1884	0.2009	322.1307	-30.6851	-29.4463
324	0.1143	0.2115	-0.1121	0.4131	-0.29	0.4138	0.1578	0.1139	0.415	0.0123	0.0272	-0.2007	-0.0791	-0.0379	0.0297	0.2157	0.2231	-0.0038	0.4228	-0.0756	0.3977	324.7424	-18.5101	-40.2125
325	0.0674	-0.0071	-0.0438	0.1886	0.3413	0.6073	-0.1535	-0.1823	-0.0158	0.1956	0.1874	-0.0338	-0.1187	-0.0578	0.0743	0.3458	0.1578	0.0966	0.255	0.0653	0.6968	315.4835	-5.3348	-45.8995
326	0.4093	1.0289	-0.7855	2.9469	-1.1327	3.4173	-0.027	-0.0952	0.1122	0.6555	0.3382	0.2015	-0.4312	-0.1564	-0.1615	0.1789	0.0099	0.0598	0.2097	-0.1543	0.2215	311.0542	-7.622	-36.9044
327	1.7237	1.0839	0.025	0.9267	-0.1934	0.4164	-0.1151	0.0754	-0.555	0.0364	-0.1158	-0.1408	0.0176	0.003	-0.0131	0.4323	-0.2338	0.1187	0.3248	-0.0921	0.3394	316.363	-7.4819	-42.5321
328	0.1397	-0.0543	0.1261	0.1418	0.0162	0.1538	-0.0557	0.1289	0.0389	-0.0461	-0.0041	0.0862	-0.0031	0.2116	-0.04	0.2666	0.0793	-0.2579	0.2656	-0.0786	0.3382	313.9675	0.6044	-26.904
329	0.3001	0.3244	-0.0275	0.3559	0.0005	0.1306	0.0426	-0.0677	-0.087	-0.0012	0.0342	-0.0387	0.0527	0.0537	0.1065	0.1795	0.1611	-0.0546	0.4898	0.0114	0.5294	304.9003	7.2953	-31.9572
330	0.7686	-0.6579	-0.3353	0.7615	0.2586	0.1501	-0.0793	-0.2324	0.1313	0.1548	0.2088	-0.2549	-0.077	0.0568	-0.0563	0.8142	-0.0183	-0.0559	0.3933	-0.1459	0.352	318.224	9.6422	-28.8905
331	2.0681	0.9142	-0.159	0.6602	-0.4772	0.6583	-0.5848	-0.2453	-0.4824	-0.0873	0.1413	-0.3727	0.8667	0.7859	0.4664	0.6986	0.3483	0.0016	0.7374	-0.2723	1.2501	334.0834	4.5767	-35.7374
332	0.1317	0.0282	-0.096	0.0386	0.0324	0.1534	-0.0203	-0.0228	-0.0944	0.0348	-0.0172	-0.0369	0.0476	0.0073	-0.122	0.8458	0.0077	0.0105	0.2487	0.2332	0.783	250.1246	-59.661	24.59
333	0.2677	-0.023	-0.088	0.2842	-0.0788	0.6163	-0.01	0.0295	0.1586	-0.1474	0.0478	-0.043	-0.2534	0.0066	0.0721	0.3541	0.0224	0.0502	0.1031	0.1893	0.4204	262.4424	-66.6661	10.1637
334	0.2692	-0.0559	-0.1924	0.0403	-0.0076	0.2157	-0.0387	0.0778	-0.0452	-0.0268	0.0043	0.0125	0.0547	-0.0695	-0.0549	0.0401	-0.1055	0.0126	0.1426	-0.0289	0.0209	256.7559	-63.7465	4.3572
335	0.2038	0.1159	0.4694	1.331	1.3467	2.0025	-0.0254	0.0948	-0.0491	-0.06	0.1556	-0.1439	-0.0268	0.2337	-0.122	0.1602	0.0596	-0.0523	0.5278	-0.2676	0.3235	255.0114	-77.1212	-4.8233
336	2.1113	1.0582	-2.1007	0.6301	-0.4012	6.4166	0.0814	-0.035	0.0708	0.2265	0.0032	0.1258	-0.1043	-0.0879	0.0214	0.5751	0.1918	0.121	0.4652	0.086	0.2008	259.3967	-87.1805	-13.5473
337	0.1214	-0.1451	-0.0552	0.2313	-0.0422	0.2469	0.1645	0.0021	0.1351	-0.0129	-0.014	0.1233	-0.1042	-0.0027	0.0099	0.5063	-0.1487	-0.0661	0.1743	0.0872	0.5732	263.9073	-97.734	-26.6855
338	0.8053	0.4608	1.3036	1.6672	3.0909	6.0306	0.1037	-0.1682	-0.1075	0.2301	-0.0233	-0.0698	-0.133	-0.3756	-0.0791	0.7204	0.2353	0.0988	0.612	0.2568	0.3915	253.7901	-104.7411	-21.9663
339	5.3981	1.1599	0.378	1.549	0.3743	7.5793	0.0812	0.315	0.0991	-0.0194	-0.1672	0.1482	-0.1564	-0.3092	-0.0418	0.2541	0.0421	0.1747	0.2654	-0.039	0.2491	266.4214	-102.6468	-15.7933
340	0.7337	-0.0624	-0.2366	1.7318	0.2728	0.1133	0.0192	0.0369	0.2168	-0.091	-0.0447	0.0011	-0.2423	-0.0271	-0.0094	0.5317	0.2065	0.0251	0.2114	-0.0273	0.5977	264.6052	-109.3183	-25.2552
341	1.3067	-0.7299	1.0538	0.8599	-0.8465	2.0662	0.0558	0.0345	0.0737	-0.0846	-0.0098	-0.2736	-0.3781	0.1878	-0.1057	0.4611	-0.1791	0.0714	0.3549	0.2381	0.5243	258.3515	-109.0931	-30.0655
342	0.0812	0.0961	-0.0329	0.1633	0.061	0.2207	-0.0058	-0.1064	-0.098	0.0222	0.0174	-0.1653	0.1405	0.1717	0.3032	0.4173	0.3214	-0.1896	0.5042	0.1798	0.6602	260.884	-105.4915	-4.8522
343	4.5652	0.8147	-0.1667	1.0074	-0.0703	1.5131	0.0525	-0.059	-0.1222	0.0537	-0.0364	-0.2356	-0.0192	0.1033	0.0079	0.3556	-0.2911	-0.0578	0.7514	-0.0164	0.9218	251.8431	-102.8668	6.1897
344	0.2593	-0.1017	0.0219	0.1258	-0.0735	0.0511	-0.0376	-0.0066	0.1434	0.0338	0.005	-0.0196	-0.0158	-0.0102	-0.108	0.0929	0.0132	-0.1026	0.069	-0.0284	0.3488	258.1977	-112.9379	-9.7342
345	4.9938	-2.243	3.2718	5.4665	-4.5697	8.4263	0.1781	-0.1271	-0.1378	-0.1677	0.0305	0.0954	0.3565	-0.6969	-0.1373	0.7536	0.0455	-0.2122	0.4517	0.2273	0.4851	255.6127	-114.5633	-5.1648
346	1.305	1.7198	-0.1215	2.9607	0.4576	1.14	0.4335	0.0788	-0.424	0.1553	-0.0227	-0.0767	0.6917	-0.0966	-0.2576	0.4312	-0.1067	-0.1557	0.6702	-0.1909	0.4163	254.5303	-94.7557	9.6679
347	0.0867	0.0367	-0.1278	0.0156	-0.0538	0.1858	0.04	-0.0125	0.1156	0.0217	0.0808	0.0437	-0.0956	-0.0577	0.1137	0.3927	0.2354	0.0832	0.2526	0.1245	0.4862	247.0127	-70.1272	0.9285
348	2.8947	-1.9574	1.6289	1.4939	-1.3987	1.4274	-0.1884	0.4488	0.2287	-0.5066	-0.1526	1.482	0.2708	-0.2253	0.2716	0.7422	-0.401	0.1536	1.0181	-0.2701	1.2846	254.5926	-95.4845	6.4341
349	0.6317	-0.2519	-0.312	0.6713	-0.1699	1.8912	-0.0416	-0.0464	0.0364	0.0833	-0.0265	0.0239	-0.0168	-0.0965	0.0088	0.6755	0.0899	0.1255	0.5051	-0.2719	0.4118	261.0754	-115.9511	-0.9566
350	0.1447	0.1206	0.0875	0.1239	-0.0704	0.9204	0.141	0.2031	-0.0958	0.1024	-0.155	-0.1956	0.0953	0.3982	0.3411	0.5313	0.1487	-0.3113	0.438	0.1208	0.5639	291.2111	-53.4599	19.7218
351	2.25	-0.3714	0.2866	0.6436	0.085	1.3624	0.2392	-0.3559	0.119	0.1126	0.1211	0.0256	0.0836	-0.1501	0.1291	0.1332	-0.0511	-0.0448	0.4899	0.0588	0.2979	299.3842	-50.3564	22.3506
352	5.3847	-1.1766	-1.3828	0.3831	0.6801	1.4941	-0.0706	-0.2939	-0.2356	-0.0708	-0.0115	0.052	0.2844	0.3878	0.0249	0.3909	0.1803	0.2175	0.6563	-0.0376	0.7629	303.1021	-64.6942	29.0618
353	3.0361	-2.8025	0.5138	3.2745	-0.4092	0.1526	-0.2577	-0.2592	-0.2522	0.0029	0.3126	0.4284	0.1212	-0.1726	-0.2001	0.3441	-0.1652	0.0022	1.0076	0.2654	0.4321	286.3436	-56.1522	20.2127
354	0.3563	-0.241	-0.3417	0.2739	0.1167	0.4163	-0.248	-0.0912	-0.0678	0.009	0.0084	-0.0306	0.1283	0.1813	-0.1532	0.4804	0.2311	-0.029	0.3154	0.2585	0.4247	275.2787	-37.8366	16.61
355	3.2834	-1.8013	-5.6669	1.3117	3.0097	9.8097	-0.5027	-0.5313	-1.1276	0.2789	0.2968	0.4041	1.5107	1.7838	0.2672	0.6578	0.2377	-0.2106	0.7557	0.07	1.7984	300.7568	-67.1548	24.3829
356	3.1626	-0.8919	-0.6009	0.8159	0.0404	0.6516	-0.1927	-0.6522	-0.2245	0.3507	0.0207	-0.3103	0.172	0.5888	0.1505	0.4076	0.1316	-0.1631	0.3764	0.09	0.371	269.826	-7.4799	65.7967
357	0.566	0.6936	-0.8159	0.9362	-1.3387	2.5026	-0.097	-0.4683	0.0187	-0.1767	-0.0104	-0.2949	0.1974	0.9139	0.1446	0.77	-0.2505	0.3729	0.7137	-0.2258	0.5604	287.6673	-9.2342	55.4598
358	0.3961	0.2347	-0.0292	0.8619	0.0853	0.9427	-0.0162	0.0086	0.0032	0.0086	0.0141	-0.0205	-0.0015	0.0216	-0.1793	0.3377	0.1541	-0.2439	0.6454	0.1198	0.5225	284.2892	-3.503	58.2011
359	1.4185	0.9165	1.7358	2.9722	0.1562	2.5178	-0.0055	-0.0944	0.0779	0.4733	-0.0913	-0.3543	-0.2448	0.0425	-0.3184	0.4007	-0.1445	0.1967	0.2774	-0.2251	0.5922	273.6437	-0.0711	63.064
360	0.2873	-0.1439	-0.2347	0.3764	0.1801	0.9294	0.0635	-0.0617	0.1395	0.223	0.0904	0.0527	-0.1369	0.0148	0.1176	0.5312	0.1248	0.3112	0.6621	-0.1555	0.4791	276.72	-1.0486	52.1181
361	2.2479	0.0185	-1.5093	0.5906	0.5833	1.8962	-0.019	0.0327	0.0423	-0.0329	0.0811	-0.0564	-0.0263	0.0605	0.168	0.1294	0.0875	0.1841	0.3744	0.0656	0.3131	271.6481	-26.6883	41.6457
362	0.4811	-0.0561	-0.1511	0.9042	-0.4035	0.2447	-0.0977	-0.1368	0.0658	-0.0881	0.0879	-0.0473	-0.3682	0.067	0.0143	0.6013	0.0569	0.0848	0.4075	-0.3428	0.4937	277.3979	-6.7944	53.5689
363	0.5518	0.3961	0.2002	5.4223	1.3596	0.3598	0.2325	-0.2282	-0.0993	0.5229	-0.3132	-0.3466	0.147	-0.1897	0.0636	0.2659	-0.2436	0.0544	0.3839	-0.0926	0.2471	288.9384	-4.123	67.0319
364	7.5872	4.9747	2.9711	4.9633	3.7834	3.8122	-1.0656	-0.0328	1.315	-0.2522	0.2423	-0.1221	-1.386	-0.4589	0.7798	0.8852	-0.1707	-0.3586	0.8073	-0.0033	0.4984	259.3039	-51.326	70.2774
365	0.8891	-0.836	0.8699	1.0287	-1.1803	1.3896	0.0207	-0.1293	-0.0726	0.0541	0.076	0.0452	0.0633	-0.2278	-0.0093	0.8589	-0.2006	-0.2655	0.482	0.1811	0.3366	270.1349	-62.4101	68.6518
366	0.1315	-0.117	0.0337	0.3196	-0.1715	0.2818	-0.0057	-0.0134	-0.0214	0.0184	0.1034	0.1492	-0.0137	-0.1114	0.0321	0.7817	-0.0056	-0.1538	0.8458	0.4973	0.5794	274.0208	-54.1033	61.3277
367	2.1891	0.4319	-0.6359	0.2667	-0.6546	1.6937	-0.1548	-0.9142	-0.3503	0.4015	-0.2755	0.5631	-0.0688	0.007	0.4456	0.6121	0.2327	0.2141	0.6101	0.0238	0.8238	281.6693	-52.7117	59.6847
368	2.105	0.9319	-0.3404	0.477	0.5066	6.5768	0.4323	-0.6308	0.182	0.8592	-0.1054	0.3687	-0.8989	-0.9355	-0.5355	1.3729	0.1906	0.2538	1.2435	0.3941	0.5579	256.3934	-60.5079	79.2486
369	4.6209	6.2877	4.4745	8.8184	6.5984	5.3201	-0.2594	-0.0624	-0.0102	0.4872	-0.829	1.5521	0.3291	-1.384	0.9836	1.1387	0.2412	0.8024	1.5765	0.1334	1.9337	257.1081	-61.6571	81.5744
370	0.2528	0.2681	0.1913	0.4297	0.5186	0.8424	-0.0327	-0.1235	0.0397	-0.0225	0.0497	-0.1334	-0.1857	0.0148	-0.0793	0.7963	0.2118	-0.2198	0.7414	-0.4949	0.7325	222.6045	-88.0878	-63.7446
371	1.095	-0.6051	0.4226	0.4018	-0.3488	0.3612	0.3614	-0.3978	-0.3132	-0.0636	-0.0072	-0.0666	0.1384	-0.4957	0.2054	0.6129	-0.057	-0.258	0.8308	-0.2982	0.6089	218.8696	-84.1319	-68.9441
372	1.6009	0.972	-0.1011	1.4523	-0.2769	1.8292	0.0981	-0.0568	0.1242	-0.1863	0.0334	-0.0352	0.0493	0.0966	0.1147	0.5767	-0.0349	0.256	0.2548	0.125	0.4574	215.1889	-80.4929	-68.1132
373	2.6136	2.0904	-0.9945	6.6783	-1.7461	0.5583	-0.1693	0.2611	-0.3283	-0.5396	0.4707	0.2582	-0.4718	0.249	-0.3102	1.4154	-0.2852	-0.5973	1.0092	0.2747	0.8502	218.6332	-56.7981	-85.8798
374	3.2309	-0.7309	-0.4074	3.6026	-2.6332	3.9758	-0.0575	0.9326	-0.5024	-0.6769	0.3427	0.0091	0.2828	-0.0284	-0.2674	0.6499	-0.3265	-0.2579	1.3938	-0.2258	1.0536	209.4857	-72.1514	-82.7293
375	0.2314	-0.1972	-0.7251	1.2711	0.3125	2.3625	-0.1465	0.4232	-0.3163	-0.4946	-0.2213	1.0315	0.5289	-0.1602	-0.0396	0.4224	0.0608	-0.1899	0.4025	0.0826	1.0716	212.9549	-52.8205	-80.5829
376	0.1093	-0.2608	-0.0201	0.7338	-0.0393	0.8961	0.0048	0.0876	0.0426	0.0417	0.0168	-0.0596	-0.0549	0.0805	0.0014	0.3962	-0.279	-0.0143	0.4109	-0.0242	0.7054	211.875	-35.9468	-49.9813
377	0.3164	0.3595	-0.2944	0.7509	-0.6657	0.5934	0.0086	-0.0328	0.01	0.0109	-0.0077	-0.0193	0.0105	0.0023	-0.0868	0.3117	0.1059	-0.1691	0.3918	0.1053	0.2625	214.1298	-39.4344	-29.7146
378	1.9142	2.4971	-1.4483	3.5393	-2.3071	1.7149	-0.1563	0.2239	-1.0522	-0.3427	0.3061	-1.0677	0.0149	0.0093	-0.1202	0.881	0.0283	0.1313	0.3807	0.0164	0.8901	196.3241	-64.1515	-22.5415
379	0.6733	-0.4703	0.4658	2.2154	0.9441	1.1792	-0.1074	0.0809	-0.2533	-0.8147	-0.3148	-0.1894	0.0166	0.0024	0.3039	0.8027	0.338	0.2029	0.5342	-0.047	0.7636	188.1607	-63.6672	-25.6673
380	5.4598	0.0269	3.5049	2.0297	1.2535	3.0027	-0.0127	-1.0242	-0.4073	0.2893	-0.2684	0.1665	0.4376	-0.2036	0.2605	0.9587	-0.028	0.4521	1.0606	-0.0229	0.5778	190.6076	-72.3344	-34.6656
381	1.5881	1.8897	-0.885	2.6996	-0.7089	0.8051	0.4459	-0.1435	0.309	0.4649	-0.1358	0.2238	0.3054	0.097	-0.257	0.7979	-0.3763	0.3055	0.8494	-0.2015	0.7639	187.6708	-70.7895	-32.2415
382	0.3338	0.2148	0.0297	0.4721	0.5664	0.883	0.164	-0.0084	0.0911	-0.0079	-0.078	-0.0066	-0.2308	0.139	0.043	0.3486	-0.0196	0.1195	0.4149	0.2427	0.3074	211.0654	-6.4165	25.6599
383	0.3677	0.3499	0.257	0.6752	0.0278	0.3082	0.1799	0.0261	0.0485	0.0218	0.1089	-0.0404	0.1229	0.5104	0.0985	0.1337	0.0434	-0.0247	0.4887	0.0834	0.6536	202.8114	-15.7591	9.9868
384	0.042	-0.1045	-0.0162	0.3131	0.0667	0.0195	-0.0437	-0.0816	0.1249	0.3152	0.0401	0.3874	-0.4507	0.0559	0.1376	0.6318	-0.1076	0.1203	0.187	-0.0095	0.5224	210.8735	9.8277	36.2058
385	0.4714	0.0001	0.3197	0.2192	-0.0623	0.234	0.0688	0.0964	0.0414	-0.0363	-0.0664	-0.0225	-0.041	-0.0287	-0.0102	0.3573	0.045	0.3611	1.0108	-0.0472	0.9225	204.024	10.5772	47.8207
386	3.7114	1.5903	0.4225	0.918	0.0921	0.8965	0.0419	-0.1301	0.1333	0.0112	-0.0206	-0.0844	-0.1029	0.1376	0.0296	0.0286	-0.0615	0.0057	0.1701	-0.042	0.3449	213.8231	10.0032	50.5614
387	0.1109	0.1343	0.0134	0.2987	-0.176	0.2734	-0.0526	0.0472	-0.0307	-0.1089	0.0471	-0.0412	0.0032	0.0055	-0.0322	0.7592	-0.2566	0.1229	0.2066	-0.0812	0.2015	261.6586	-23.847	83.7634
388	1.5009	1.4784	-0.1467	1.8715	-0.7305	0.8395	0.3714	-0.3724	0.5253	0.3337	-0.1321	0.3183	-0.1501	-0.1789	-0.0856	0.5123	-0.3452	0.1559	0.6266	-0.1816	0.6232	267.7546	-10.8757	76.2003
389	5.5787	-3.1315	0.4835	2.816	-0.1551	0.0547	-0.251	-0.2414	-0.3665	0.1899	0.2385	0.1153	-0.0876	-0.3421	0.2359	0.3741	0.2569	0.0265	0.7877	-0.2159	0.4344	279.2587	-21.6425	67.5614
390	0.5811	-0.2926	0.0412	0.3881	0.638	1.8043	-0.3835	-0.1536	-0.0676	0.025	0.2631	-0.0306	0.103	0.2941	-0.0197	1.0222	-0.2162	0.0845	0.9387	0.0922	0.3166	258.4035	-16.9083	74.8608
391	4.9172	2.0418	4.1829	1.3844	0.6661	5.6809	0.6544	-1.0623	-1.2809	0.9535	-0.4912	1.1788	0.95	-0.8893	-0.0796	0.7497	-0.0272	0.326	0.553	-0.1016	1.2858	228.2059	-93.9116	-22.9101
392	0.1853	-0.2982	-0.1302	0.6903	0.7168	1.3187	0.0122	0.0202	0.0243	-0.1095	-0.0333	-0.023	-0.1643	-0.0619	-0.0514	0.231	-0.1528	0.1032	0.3435	-0.1942	0.1349	227.2498	-81.669	-18.2794
393	7.4084	-6.5545	-2.8991	5.8061	2.4187	3.9889	-0.0056	0.1202	-0.5444	-0.0913	-0.1846	0.4221	0.0202	-0.2246	0.0689	0.375	0.2221	-0.0505	0.3066	0.0404	0.5575	229.4968	-94.8339	-17.4683
394	2.2752	3.1028	-1.4969	7.3911	-4.5531	4.9098	-0.4657	-0.1492	0.0765	0.8091	-0.4425	-1.7083	-0.0101	0.8604	0.8724	1.1008	0.1816	0.0672	0.5626	0.3658	1.3856	216.4269	-96.1157	-23.4292
395	0.07	0.1681	0.0053	2.7558	-0.6835	0.2055	0.0918	0.1081	-0.1084	-0.1391	-0.1114	-0.1292	0.0697	0.0652	0.0055	0.5019	0.2929	-0.1415	0.3334	-0.0509	0.2667	220.4684	-87.6579	-26.5324
396	4.0445	1.3096	1.9983	0.8649	0.6923	0.9914	0.2217	-0.2505	-0.7694	0.2265	-0.1272	0.2142	0.5893	0.0571	-0.1169	1.5635	0.4486	0.3131	0.9671	0.5572	1.379	227.625	-95.5206	-26.6913
397	6.6289	-0.8257	-0.2264	5.2712	0.6966	0.0938	-0.3128	1.0934	1.1859	-2.2246	0.0966	-0.1064	-0.3828	-0.333	0.2275	1.6378	0.1103	-0.0038	1.2921	0.1237	1.3551	151.8537	-30.5021	-70.2846
398	2.1267	0.9087	-0.5506	2.5673	-0.4694	0.1667	-0.6131	-0.0138	-0.4545	-0.3327	0.0713	0.4008	1.4253	-1.3435	0.4591	1.257	-0.6605	0.2791	2.7586	0.181	2.2684	171.8975	-17.677	-106.5321
399	0.6861	0.4417	-0.3608	0.5387	0.3873	1.6969	-0.1908	0.4472	0.252	-0.0254	0.0578	0.0259	0.0583	0.1911	0.0947	0.8762	-0.0235	0.2263	0.6616	0.2803	0.497	270.9755	-46.0542	-1.6805
400	0.9125	0.6263	0.7392	3.1672	0.0251	2.9679	-0.2164	0.3164	-0.1638	0.0464	-0.0007	0.4849	0.6407	0.0679	0.2254	0.7229	0.0443	0.0242	0.2705	-0.1891	0.6164	293.1644	-51.225	4.7187
401	0.4446	0.1615	-0.3784	0.7101	0.0419	0.371	0.0067	-0.0294	0.002	0.0114	0.0057	-0.0002	0.0182	0.031	-0.0307	0.5208	-0.0493	-0.3016	0.7051	-0.0646	0.3707	316.4083	-48.7984	15.0191
402	0.0573	-0.2019	-0.0922	0.7131	0.4081	1.6167	0.0109	-0.1037	0.0542	0.0216	0.0653	-0.0797	0.0073	0.2082	-0.0369	0.1937	0.193	-0.038	0.4512	-0.0895	0.1186	316.3666	-42.4102	14.365
403	7.3354	-2.0174	-2.7945	2.6232	1.3637	6.4448	0.2393	0.6778	-0.399	-0.0965	0.0233	0.1521	0.7985	-0.4586	-0.183	0.3698	-0.0011	-0.2408	0.2927	0.0509	0.2891	321.3959	-37.7402	16.1544
404	3.0803	-0.2841	1.2706	0.6934	0.1689	0.6466	0.0096	-0.3043	-0.1989	0.2342	0.0685	0.0213	0.0177	-0.0899	-0.072	0.6287	0.2215	-0.1696	0.5681	0.247	0.589	184.9824	-27.3731	-17.9217
405	0.5409	0.4728	-0.1844	1.3547	0.3206	0.3088	-0.1703	-0.0968	-0.2598	0.1574	0.0878	0.2904	0.4348	0.0241	0.0977	0.965	-0.0156	-0.0943	0.3694	0.3093	0.8774	171.11	-32.3062	-6.3014
406	1.1605	0.8741	-2.0671	5.9454	-5.2863	6.3125	-0.1725	-0.1459	0.2586	-0.1076	0.0071	0.1854	-0.1698	-0.0154	0.0913	0.7144	0.3333	-0.1912	0.7333	0.2261	0.8787	181.9517	-30.5033	-19.1879
407	3.2155	1.025	-1.4984	1.1053	-0.6627	2.5792	0.0736	-0.3183	-0.0103	0.3371	-0.0171	0.1441	0.0089	-0.133	-0.0375	0.4158	-0.0597	0.2369	0.5773	0.0618	0.3092	180.0754	-23.5284	-25.3271
408	4.537	1.5116	-2.533	0.9388	0.4013	5.9407	-0.1095	0.0057	-0.2183	-0.5094	-0.0394	-0.7429	-0.3804	0.5318	0.1642	0.577	-0.1395	0.0247	0.4416	0.3333	0.8998	170.3405	-34.605	-14.3205
409	4.0201	2.9986	0.1529	2.2696	0.1973	0.2078	-0.3704	0.2072	0.439	0.156	0.1341	0.0911	-0.4611	-0.0666	0.2395	0.5249	0.3216	-0.1723	0.9025	-0.0704	0.3541	168.1348	-36.109	-8.9541
410	2.1732	1.0333	1.5451	1.0387	0.4887	1.2093	-0.2114	0.7176	1.3589	0.3248	0.242	0.571	-1.1831	0.3047	-0.0757	1.11	-0.0539	0.5019	0.6594	0.2886	1.2783	180.6365	-25.6246	-10.4232
411	0.4617	0.6391	-1.2446	1.4612	-1.7175	3.3581	-0.0336	-0.1288	-0.1296	0.0984	0.0539	0.069	0.2362	0.2682	0.1206	0.6299	0.0665	-0.1973	0.5852	0.2232	0.3922	262.4735	-11.5001	15.2325
412	1.2948	-0.1791	-0.2696	0.3892	-0.0946	0.1617	-0.025	0.0557	0.0488	-0.0388	0.0062	0.0751	-0.0286	0.0167	0.0531	0.16	-0.0987	-0.0888	0.2422	-0.0665	0.217	257.5898	-5.5813	28.2968
413	4.2479	-2.6642	-5.1054	2.0654	3.8578	7.2252	0.2719	0.275	-0.0597	-0.5171	-0.3879	0.1984	-0.6634	-0.3481	0.1104	1.0205	-0.2506	0.0202	0.8464	-0.3283	0.5086	249.0581	-8.2209	35.1461
414	1.7714	2.0405	0.4901	3.3581	0.1127	0.3381	0.0434	0.0383	-0.0908	0.0324	0.0103	-0.2644	0.0046	0.1138	0.0514	0.3014	-0.1944	0.0482	0.2998	0.0531	0.5046	242.2416	-8.6518	34.111
415	0.5069	-0.0116	0.1273	0.2204	-0.0351	0.2575	-0.0619	0.1417	-0.0107	-0.117	0.0162	0.1534	0.0541	-0.1033	-0.0136	0.2648	-0.1364	-0.1239	0.2738	-0.1141	0.3531	239.9033	-14.4551	34.2598
416	0.1377	0.0139	-0.3019	0.3099	0.0334	0.6762	-0.0571	0.0139	-0.0396	-0.0123	0.037	-0.0755	0.0905	0.1135	-0.0258	0.3019	0.0238	0.1725	0.513	-0.1711	0.3182	243.8021	-19.5588	36.6374
417	3.3473	1.3685	3.0794	1.4741	1.5323	3.3005	-0.0844	-0.057	0.1073	-0.0673	0.0381	0.0505	-0.0964	0.0617	0.042	0.2154	0.076	-0.1433	0.347	-0.2612	0.464	249.5194	-24.7629	37.9037
418	1.9406	0.9668	1.153	1.5337	0.1349	0.8683	-0.0306	0.5843	-0.4502	0.1321	0.0578	-0.5183	-0.128	0.3854	-0.0516	1.1581	-0.5299	-0.5846	0.9957	0.3215	1.133	254.0686	-16.5868	35.7324
419	0.5451	0.5653	0.4816	0.6922	0.5593	0.4595	0.1783	0.2425	-0.3869	0.0915	0.2056	-0.4782	0.2395	0.3376	-0.3192	0.697	0.406	0.1614	0.6805	0.0863	0.9018	262.6764	-8.8252	36.5758
420	0.295	0.0628	0.0238	0.9111	0.28	0.483	-0.0774	0.0127	0.0419	0.1149	0.0197	-0.0032	0.032	0.0621	-0.0547	0.621	-0.061	-0.1505	0.2389	-0.0919	0.2866	207.3868	-43.471	17.266
421	2.5382	-0.4226	0.5854	0.891	-0.6667	2.1657	-0.0054	-0.437	-0.1853	0.0821	0.0939	-0.2228	0.2982	0.041	0.0412	0.4761	0.2812	-0.1595	0.5277	0.088	0.6431	196.9451	-50.6986	7.2677
422	0.745	-0.3798	0.1847	0.2512	0.0671	0.53	-0.1676	-0.4184	-0.1633	0.0783	0.0146	-0.1593	0.136	0.2097	0.0627	0.2609	0.0833	0.1383	0.8804	0.1396	0.5595	190.549	-37.3406	-8.8564
423	8.2454	3.8498	6.4015	5.3638	4.428	5.5508	0.0639	-1.6568	1.7474	1.5752	-0.1574	1.0499	-1.2557	-1.2584	0.0668	1.1137	0.2135	0.4529	0.6351	-0.0274	0.8961	186.0272	-45.2329	-10.9166
424	1.3082	0.2436	0.7515	3.2661	-2.2203	9.8056	0.2429	0.2587	0.9982	0.2219	0.1712	1.0582	-0.5999	-1.757	-0.3081	0.5311	-0.059	0.3141	0.6433	-0.0669	0.82	191.7702	-50.3667	-2.2375
425	0.2198	0.3061	0.4574	1.9935	0.6097	0.9503	-0.1622	0.1559	-0.0093	-0.2315	0.1172	-0.0538	0.0404	0.2133	0.0597	0.451	0.0603	0.1882	0.4055	0.1973	0.2648	206.8423	-55.8181	3.1767
426	2.3609	1.344	-2.6576	5.5239	-5.0335	6.4286	-0.1503	-1.0883	-0.3802	1.262	0.312	-0.0501	-0.6859	-0.239	-0.0623	0.8516	0.2665	-0.2571	0.9756	0.1919	0.5688	207.6583	-51.0046	9.1671
427	0.0212	-0.023	-0.1685	0.4142	-0.2362	1.7826	-0.0479	-0.4163	-0.2449	0.3615	0.0185	-0.1472	0.2618	0.0749	0.0271	0.8856	0.1105	-0.1128	0.5833	0.3708	0.5541	203.8907	-49.6539	18.7462
428	1.1317	1.1723	1.764	1.2691	1.541	4.2579	0.3917	-0.2114	0.4699	0.3642	0.0276	0.5628	-0.411	0.3156	-0.3016	0.6212	0.2759	0.3284	1.1413	0.2798	0.7451	255.8505	-51.8514	-67.6482
429	1.8639	0.62	0.7868	1.457	0.6884	1.841	-0.1226	-0.0413	-0.2024	0.314	0.0786	0.3277	-0.1136	-0.157	-0.0262	0.3569	0.0477	0.0298	0.1402	-0.1188	0.3434	257.3392	-56.2505	-78.2456
430	0.5243	0.0715	-0.5602	0.1171	-0.3462	1.2774	0.0064	-0.2445	0.0434	0.0534	0.017	-0.0566	-0.0144	0.1963	-0.0662	0.0472	0.007	-0.0119	0.3367	-0.0993	0.0801	263.6622	-62.6777	-65.8489
431	2.3031	-1.0641	-1.0259	1.3291	0.8457	0.6217	0.1452	0.4301	-0.0944	-0.2384	-0.2354	0.1811	-0.1815	-0.2608	0.0328	0.5039	0.3248	0.0608	0.6262	-0.157	0.4645	262.7951	-55.2754	-70.6832
432	2.6847	-0.9018	-1.6898	1.8301	3.122	6.0557	0.0409	0.3491	0.1217	-0.6061	0.0111	-0.1358	-1.1847	-0.1268	-0.0804	0.9867	0.0565	0.1446	0.6381	-0.2985	0.502	260.5226	-51.5512	-68.127

Refinement TLS group

ID	Refine-ID	Refine TLS-ID	Selection details
1	X-RAY DIFFRACTION	1	chain 'A' and (resid 6 through 25 )
2	X-RAY DIFFRACTION	2	chain 'A' and (resid 26 through 45 )
3	X-RAY DIFFRACTION	3	chain 'A' and (resid 46 through 155 )
4	X-RAY DIFFRACTION	4	chain 'A' and (resid 160 through 209 )
5	X-RAY DIFFRACTION	5	chain 'A' and (resid 210 through 259 )
6	X-RAY DIFFRACTION	6	chain 'A' and (resid 260 through 279 )
7	X-RAY DIFFRACTION	7	chain 'A' and (resid 280 through 299 )
8	X-RAY DIFFRACTION	8	chain 'A' and (resid 302 through 321 )
9	X-RAY DIFFRACTION	9	chain 'A' and (resid 322 through 381 )
10	X-RAY DIFFRACTION	10	chain 'A' and (resid 382 through 421 )
11	X-RAY DIFFRACTION	11	chain 'A' and (resid 422 through 461 )
12	X-RAY DIFFRACTION	12	chain 'A' and (resid 462 through 521 )
13	X-RAY DIFFRACTION	13	chain 'A' and (resid 522 through 541 )
14	X-RAY DIFFRACTION	14	chain 'A' and (resid 542 through 569 )
15	X-RAY DIFFRACTION	15	chain 'A' and (resid 572 through 581 )
16	X-RAY DIFFRACTION	16	chain 'A' and (resid 582 through 621 )
17	X-RAY DIFFRACTION	17	chain 'A' and (resid 622 through 641 )
18	X-RAY DIFFRACTION	18	chain 'A' and (resid 642 through 666 )
19	X-RAY DIFFRACTION	19	chain 'A' and (resid 667 through 671 )
20	X-RAY DIFFRACTION	20	chain 'A' and (resid 672 through 678 )
21	X-RAY DIFFRACTION	21	chain 'A' and (resid 691 through 694 )
22	X-RAY DIFFRACTION	22	chain 'A' and (resid 696 through 1015 )
23	X-RAY DIFFRACTION	23	chain 'A' and (resid 1016 through 1095 )
24	X-RAY DIFFRACTION	24	chain 'A' and (resid 1096 through 1175 )
25	X-RAY DIFFRACTION	25	chain 'A' and (resid 1176 through 1255 )
26	X-RAY DIFFRACTION	26	chain 'A' and (resid 1256 through 1455 )
27	X-RAY DIFFRACTION	27	chain 'A' and (resid 1456 through 1579 )
28	X-RAY DIFFRACTION	28	chain 'A' and (resid 1584 through 2070 )
29	X-RAY DIFFRACTION	29	chain 'A' and (resid 2071 through 2150 )
30	X-RAY DIFFRACTION	30	chain 'A' and (resid 2151 through 2230 )
31	X-RAY DIFFRACTION	31	chain 'A' and (resid 2231 through 2807 )
32	X-RAY DIFFRACTION	32	chain 'A' and (resid 2812 through 2821 )
33	X-RAY DIFFRACTION	33	chain 'A' and (resid 2822 through 2841 )
34	X-RAY DIFFRACTION	34	chain 'A' and (resid 2842 through 2851 )
35	X-RAY DIFFRACTION	35	chain 'A' and (resid 2852 through 2881 )
36	X-RAY DIFFRACTION	36	chain 'A' and (resid 2882 through 2906 )
37	X-RAY DIFFRACTION	37	chain 'B' and (resid 1 through 20 )
38	X-RAY DIFFRACTION	38	chain 'B' and (resid 21 through 70 )
39	X-RAY DIFFRACTION	39	chain 'B' and (resid 71 through 110 )
40	X-RAY DIFFRACTION	40	chain 'B' and (resid 111 through 120 )
41	X-RAY DIFFRACTION	41	chain 'C' and (resid 2 through 63 )
42	X-RAY DIFFRACTION	42	chain 'C' and (resid 64 through 145 )
43	X-RAY DIFFRACTION	43	chain 'C' and (resid 146 through 260 )
44	X-RAY DIFFRACTION	44	chain 'C' and (resid 261 through 276 )
45	X-RAY DIFFRACTION	45	chain 'D' and (resid 1 through 37 )
46	X-RAY DIFFRACTION	46	chain 'D' and (resid 38 through 101 )
47	X-RAY DIFFRACTION	47	chain 'D' and (resid 102 through 160 )
48	X-RAY DIFFRACTION	48	chain 'D' and (resid 161 through 204 )
49	X-RAY DIFFRACTION	49	chain 'E' and (resid 6 through 29 )
50	X-RAY DIFFRACTION	50	chain 'E' and (resid 30 through 53 )
51	X-RAY DIFFRACTION	51	chain 'E' and (resid 54 through 73 )
52	X-RAY DIFFRACTION	52	chain 'E' and (resid 74 through 102 )
53	X-RAY DIFFRACTION	53	chain 'E' and (resid 103 through 119 )
54	X-RAY DIFFRACTION	54	chain 'E' and (resid 120 through 153 )
55	X-RAY DIFFRACTION	55	chain 'E' and (resid 154 through 190 )
56	X-RAY DIFFRACTION	56	chain 'E' and (resid 191 through 208 )
57	X-RAY DIFFRACTION	57	chain 'F' and (resid 2 through 23 )
58	X-RAY DIFFRACTION	58	chain 'F' and (resid 24 through 95 )
59	X-RAY DIFFRACTION	59	chain 'F' and (resid 96 through 118 )
60	X-RAY DIFFRACTION	60	chain 'F' and (resid 119 through 154 )
61	X-RAY DIFFRACTION	61	chain 'F' and (resid 155 through 165 )
62	X-RAY DIFFRACTION	62	chain 'F' and (resid 166 through 182 )
63	X-RAY DIFFRACTION	63	chain 'G' and (resid 2 through 15 )
64	X-RAY DIFFRACTION	64	chain 'G' and (resid 16 through 46 )
65	X-RAY DIFFRACTION	65	chain 'G' and (resid 47 through 58 )
66	X-RAY DIFFRACTION	66	chain 'G' and (resid 59 through 90 )
67	X-RAY DIFFRACTION	67	chain 'G' and (resid 91 through 99 )
68	X-RAY DIFFRACTION	68	chain 'G' and (resid 100 through 152 )
69	X-RAY DIFFRACTION	69	chain 'G' and (resid 153 through 175 )
70	X-RAY DIFFRACTION	70	chain 'H' and (resid 1 through 71 )
71	X-RAY DIFFRACTION	71	chain 'H' and (resid 72 through 100)
72	X-RAY DIFFRACTION	72	chain 'I' and (resid 1 through 12 )
73	X-RAY DIFFRACTION	73	chain 'I' and (resid 13 through 59 )
74	X-RAY DIFFRACTION	74	chain 'I' and (resid 60 through 81 )
75	X-RAY DIFFRACTION	75	chain 'I' and (resid 82 through 94 )
76	X-RAY DIFFRACTION	76	chain 'I' and (resid 95 through 106 )
77	X-RAY DIFFRACTION	77	chain 'I' and (resid 107 through 122 )
78	X-RAY DIFFRACTION	78	chain 'I' and (resid 123 through 130 )
79	X-RAY DIFFRACTION	79	chain 'I' and (resid 131 through 140 )
80	X-RAY DIFFRACTION	80	chain 'J' and (resid 1 through 9 )
81	X-RAY DIFFRACTION	81	chain 'J' and (resid 10 through 17 )
82	X-RAY DIFFRACTION	82	chain 'J' and (resid 18 through 24 )
83	X-RAY DIFFRACTION	83	chain 'J' and (resid 25 through 43 )
84	X-RAY DIFFRACTION	84	chain 'J' and (resid 44 through 64 )
85	X-RAY DIFFRACTION	85	chain 'J' and (resid 65 through 87 )
86	X-RAY DIFFRACTION	86	chain 'J' and (resid 88 through 97 )
87	X-RAY DIFFRACTION	87	chain 'J' and (resid 98 through 122 )
88	X-RAY DIFFRACTION	88	chain 'K' and (resid 1 through 10 )
89	X-RAY DIFFRACTION	89	chain 'K' and (resid 11 through 25 )
90	X-RAY DIFFRACTION	90	chain 'K' and (resid 26 through 71 )
91	X-RAY DIFFRACTION	91	chain 'K' and (resid 72 through 88 )
92	X-RAY DIFFRACTION	92	chain 'K' and (resid 89 through 96 )
93	X-RAY DIFFRACTION	93	chain 'K' and (resid 97 through 110 )
94	X-RAY DIFFRACTION	94	chain 'K' and (resid 111 through 149 )
95	X-RAY DIFFRACTION	95	chain 'L' and (resid 1 through 10 )
96	X-RAY DIFFRACTION	96	chain 'L' and (resid 11 through 30 )
97	X-RAY DIFFRACTION	97	chain 'L' and (resid 31 through 39 )
98	X-RAY DIFFRACTION	98	chain 'L' and (resid 40 through 58 )
99	X-RAY DIFFRACTION	99	chain 'L' and (resid 59 through 66 )
100	X-RAY DIFFRACTION	100	chain 'L' and (resid 67 through 76 )
101	X-RAY DIFFRACTION	101	chain 'L' and (resid 77 through 88 )
102	X-RAY DIFFRACTION	102	chain 'L' and (resid 89 through 97 )
103	X-RAY DIFFRACTION	103	chain 'L' and (resid 98 through 110 )
104	X-RAY DIFFRACTION	104	chain 'L' and (resid 111 through 133 )
105	X-RAY DIFFRACTION	105	chain 'L' and (resid 134 through 141 )
106	X-RAY DIFFRACTION	106	chain 'M' and (resid 1 through 13 )
107	X-RAY DIFFRACTION	107	chain 'M' and (resid 14 through 32 )
108	X-RAY DIFFRACTION	108	chain 'M' and (resid 33 through 57 )
109	X-RAY DIFFRACTION	109	chain 'M' and (resid 58 through 81 )
110	X-RAY DIFFRACTION	110	chain 'M' and (resid 82 through 94 )
111	X-RAY DIFFRACTION	111	chain 'M' and (resid 95 through 99 )
112	X-RAY DIFFRACTION	112	chain 'M' and (resid 100 through 110 )
113	X-RAY DIFFRACTION	113	chain 'M' and (resid 111 through 118 )
114	X-RAY DIFFRACTION	114	chain 'N' and (resid 3 through 21 )
115	X-RAY DIFFRACTION	115	chain 'N' and (resid 22 through 61 )
116	X-RAY DIFFRACTION	116	chain 'N' and (resid 62 through 80 )
117	X-RAY DIFFRACTION	117	chain 'N' and (resid 81 through 112 )
118	X-RAY DIFFRACTION	118	chain 'O' and (resid 1 through 14 )
119	X-RAY DIFFRACTION	119	chain 'O' and (resid 15 through 67 )
120	X-RAY DIFFRACTION	120	chain 'O' and (resid 68 through 99 )
121	X-RAY DIFFRACTION	121	chain 'O' and (resid 100 through 106 )
122	X-RAY DIFFRACTION	122	chain 'O' and (resid 107 through 117 )
123	X-RAY DIFFRACTION	123	chain 'O' and (resid 118 through 131 )
124	X-RAY DIFFRACTION	124	chain 'P' and (resid 2 through 20 )
125	X-RAY DIFFRACTION	125	chain 'P' and (resid 21 through 71 )
126	X-RAY DIFFRACTION	126	chain 'P' and (resid 72 through 102 )
127	X-RAY DIFFRACTION	127	chain 'P' and (resid 103 through 117 )
128	X-RAY DIFFRACTION	128	chain 'Q' and (resid 1 through 14 )
129	X-RAY DIFFRACTION	129	chain 'Q' and (resid 15 through 41 )
130	X-RAY DIFFRACTION	130	chain 'Q' and (resid 42 through 69 )
131	X-RAY DIFFRACTION	131	chain 'Q' and (resid 70 through 101 )
132	X-RAY DIFFRACTION	132	chain 'R' and (resid 1 through 28 )
133	X-RAY DIFFRACTION	133	chain 'R' and (resid 29 through 41 )
134	X-RAY DIFFRACTION	134	chain 'R' and (resid 42 through 60 )
135	X-RAY DIFFRACTION	135	chain 'R' and (resid 61 through 65 )
136	X-RAY DIFFRACTION	136	chain 'R' and (resid 66 through 78 )
137	X-RAY DIFFRACTION	137	chain 'R' and (resid 79 through 87 )
138	X-RAY DIFFRACTION	138	chain 'R' and (resid 88 through 92 )
139	X-RAY DIFFRACTION	139	chain 'R' and (resid 93 through 100 )
140	X-RAY DIFFRACTION	140	chain 'R' and (resid 101 through 112 )
141	X-RAY DIFFRACTION	141	chain 'S' and (resid 1 through 11 )
142	X-RAY DIFFRACTION	142	chain 'S' and (resid 12 through 23 )
143	X-RAY DIFFRACTION	143	chain 'S' and (resid 24 through 30 )
144	X-RAY DIFFRACTION	144	chain 'S' and (resid 31 through 47 )
145	X-RAY DIFFRACTION	145	chain 'S' and (resid 48 through 59 )
146	X-RAY DIFFRACTION	146	chain 'S' and (resid 60 through 66 )
147	X-RAY DIFFRACTION	147	chain 'S' and (resid 67 through 75 )
148	X-RAY DIFFRACTION	148	chain 'S' and (resid 76 through 83 )
149	X-RAY DIFFRACTION	149	chain 'S' and (resid 84 through 89 )
150	X-RAY DIFFRACTION	150	chain 'S' and (resid 90 through 95 )
151	X-RAY DIFFRACTION	151	chain 'T' and (resid 1 through 11 )
152	X-RAY DIFFRACTION	152	chain 'T' and (resid 12 through 23 )
153	X-RAY DIFFRACTION	153	chain 'T' and (resid 24 through 34 )
154	X-RAY DIFFRACTION	154	chain 'T' and (resid 35 through 48 )
155	X-RAY DIFFRACTION	155	chain 'T' and (resid 49 through 68 )
156	X-RAY DIFFRACTION	156	chain 'T' and (resid 69 through 84 )
157	X-RAY DIFFRACTION	157	chain 'T' and (resid 85 through 107 )
158	X-RAY DIFFRACTION	158	chain 'U' and (resid 1 through 22 )
159	X-RAY DIFFRACTION	159	chain 'U' and (resid 23 through 51 )
160	X-RAY DIFFRACTION	160	chain 'U' and (resid 52 through 94 )
161	X-RAY DIFFRACTION	161	chain 'U' and (resid 95 through 105 )
162	X-RAY DIFFRACTION	162	chain 'U' and (resid 106 through 154 )
163	X-RAY DIFFRACTION	163	chain 'U' and (resid 155 through 169 )
164	X-RAY DIFFRACTION	164	chain 'U' and (resid 170 through 187 )
165	X-RAY DIFFRACTION	165	chain 'U' and (resid 188 through 203 )
166	X-RAY DIFFRACTION	166	chain 'V' and (resid 8 through 17 )
167	X-RAY DIFFRACTION	167	chain 'V' and (resid 18 through 27 )
168	X-RAY DIFFRACTION	168	chain 'V' and (resid 28 through 42 )
169	X-RAY DIFFRACTION	169	chain 'V' and (resid 43 through 47 )
170	X-RAY DIFFRACTION	170	chain 'V' and (resid 48 through 53 )
171	X-RAY DIFFRACTION	171	chain 'V' and (resid 54 through 64 )
172	X-RAY DIFFRACTION	172	chain 'V' and (resid 65 through 76 )
173	X-RAY DIFFRACTION	173	chain 'V' and (resid 77 through 84 )
174	X-RAY DIFFRACTION	174	chain 'W' and (resid 2 through 42 )
175	X-RAY DIFFRACTION	175	chain 'W' and (resid 43 through 98 )
176	X-RAY DIFFRACTION	176	chain 'X' and (resid 1 through 17 )
177	X-RAY DIFFRACTION	177	chain 'X' and (resid 18 through 40 )
178	X-RAY DIFFRACTION	178	chain 'X' and (resid 41 through 70 )
179	X-RAY DIFFRACTION	179	chain 'Y' and (resid 2 through 8 )
180	X-RAY DIFFRACTION	180	chain 'Y' and (resid 9 through 33 )
181	X-RAY DIFFRACTION	181	chain 'Y' and (resid 34 through 40 )
182	X-RAY DIFFRACTION	182	chain 'Y' and (resid 41 through 49 )
183	X-RAY DIFFRACTION	183	chain 'Y' and (resid 50 through 60 )
184	X-RAY DIFFRACTION	184	chain 'Z' and (resid 1 through 26 )
185	X-RAY DIFFRACTION	185	chain 'Z' and (resid 27 through 48 )
186	X-RAY DIFFRACTION	186	chain 'Z' and (resid 49 through 69 )
187	X-RAY DIFFRACTION	187	chain '0' and (resid 2 through 12 )
188	X-RAY DIFFRACTION	188	chain '0' and (resid 13 through 22 )
189	X-RAY DIFFRACTION	189	chain '0' and (resid 23 through 32 )
190	X-RAY DIFFRACTION	190	chain '0' and (resid 33 through 37 )
191	X-RAY DIFFRACTION	191	chain '0' and (resid 38 through 42 )
192	X-RAY DIFFRACTION	192	chain '0' and (resid 43 through 47 )
193	X-RAY DIFFRACTION	193	chain '0' and (resid 48 through 52 )
194	X-RAY DIFFRACTION	194	chain '0' and (resid 53 through 57 )
195	X-RAY DIFFRACTION	195	chain '0' and (resid 58 through 60 )
196	X-RAY DIFFRACTION	196	chain '1' and (resid 2 through 34 )
197	X-RAY DIFFRACTION	197	chain '1' and (resid 35 through 54 )
198	X-RAY DIFFRACTION	198	chain '2' and (resid 1 through 24 )
199	X-RAY DIFFRACTION	199	chain '2' and (resid 25 through 37 )
200	X-RAY DIFFRACTION	200	chain '2' and (resid 38 through 48 )
201	X-RAY DIFFRACTION	201	chain '3' and (resid 2 through 45 )
202	X-RAY DIFFRACTION	202	chain '3' and (resid 46 through 51 )
203	X-RAY DIFFRACTION	203	chain '3' and (resid 52 through 65 )
204	X-RAY DIFFRACTION	204	chain '4' and (resid 1 through 19 )
205	X-RAY DIFFRACTION	205	chain '4' and (resid 20 through 37 )
206	X-RAY DIFFRACTION	206	chain 'a' and (resid 6 through 25 )
207	X-RAY DIFFRACTION	207	chain 'a' and (resid 26 through 45 )
208	X-RAY DIFFRACTION	208	chain 'a' and (resid 46 through 155 )
209	X-RAY DIFFRACTION	209	chain 'a' and (resid 160 through 179 )
210	X-RAY DIFFRACTION	210	chain 'a' and (resid 180 through 209 )
211	X-RAY DIFFRACTION	211	chain 'a' and (resid 210 through 279 )
212	X-RAY DIFFRACTION	212	chain 'a' and (resid 280 through 299 )
213	X-RAY DIFFRACTION	213	chain 'a' and (resid 302 through 321 )
214	X-RAY DIFFRACTION	214	chain 'a' and (resid 322 through 381 )
215	X-RAY DIFFRACTION	215	chain 'a' and (resid 382 through 421 )
216	X-RAY DIFFRACTION	216	chain 'a' and (resid 422 through 461 )
217	X-RAY DIFFRACTION	217	chain 'a' and (resid 462 through 521 )
218	X-RAY DIFFRACTION	218	chain 'a' and (resid 522 through 541 )
219	X-RAY DIFFRACTION	219	chain 'a' and (resid 542 through 569 )
220	X-RAY DIFFRACTION	220	chain 'a' and (resid 572 through 581 )
221	X-RAY DIFFRACTION	221	chain 'a' and (resid 582 through 621 )
222	X-RAY DIFFRACTION	222	chain 'a' and (resid 622 through 651 )
223	X-RAY DIFFRACTION	223	chain 'a' and (resid 652 through 666 )
224	X-RAY DIFFRACTION	224	chain 'a' and (resid 667 through 671 )
225	X-RAY DIFFRACTION	225	chain 'a' and (resid 672 through 678 )
226	X-RAY DIFFRACTION	226	chain 'a' and (resid 691 through 694 )
227	X-RAY DIFFRACTION	227	chain 'a' and (resid 696 through 1015 )
228	X-RAY DIFFRACTION	228	chain 'a' and (resid 1016 through 1095 )
229	X-RAY DIFFRACTION	229	chain 'a' and (resid 1096 through 1175 )
230	X-RAY DIFFRACTION	230	chain 'a' and (resid 1176 through 1255 )
231	X-RAY DIFFRACTION	231	chain 'a' and (resid 1256 through 1455 )
232	X-RAY DIFFRACTION	232	chain 'a' and (resid 1456 through 1579 )
233	X-RAY DIFFRACTION	233	chain 'a' and (resid 1584 through 2070 )
234	X-RAY DIFFRACTION	234	chain 'a' and (resid 2071 through 2150 )
235	X-RAY DIFFRACTION	235	chain 'a' and (resid 2151 through 2230 )
236	X-RAY DIFFRACTION	236	chain 'a' and (resid 2231 through 2807 )
237	X-RAY DIFFRACTION	237	chain 'a' and (resid 2812 through 2821 )
238	X-RAY DIFFRACTION	238	chain 'a' and (resid 2822 through 2851 )
239	X-RAY DIFFRACTION	239	chain 'a' and (resid 2852 through 2906 )
240	X-RAY DIFFRACTION	240	chain 'b' and (resid 1 through 20 )
241	X-RAY DIFFRACTION	241	chain 'b' and (resid 21 through 70 )
242	X-RAY DIFFRACTION	242	chain 'b' and (resid 71 through 110 )
243	X-RAY DIFFRACTION	243	chain 'b' and (resid 111 through 120 )
244	X-RAY DIFFRACTION	244	chain 'c' and (resid 2 through 61 )
245	X-RAY DIFFRACTION	245	chain 'c' and (resid 62 through 241 )
246	X-RAY DIFFRACTION	246	chain 'c' and (resid 242 through 276 )
247	X-RAY DIFFRACTION	247	chain 'd' and (resid 1 through 20 )
248	X-RAY DIFFRACTION	248	chain 'd' and (resid 21 through 60 )
249	X-RAY DIFFRACTION	249	chain 'd' and (resid 61 through 100 )
250	X-RAY DIFFRACTION	250	chain 'd' and (resid 101 through 120 )
251	X-RAY DIFFRACTION	251	chain 'd' and (resid 121 through 160 )
252	X-RAY DIFFRACTION	252	chain 'd' and (resid 161 through 204 )
253	X-RAY DIFFRACTION	253	chain 'e' and (resid 6 through 45 )
254	X-RAY DIFFRACTION	254	chain 'e' and (resid 46 through 85 )
255	X-RAY DIFFRACTION	255	chain 'e' and (resid 86 through 125 )
256	X-RAY DIFFRACTION	256	chain 'e' and (resid 126 through 165 )
257	X-RAY DIFFRACTION	257	chain 'e' and (resid 166 through 185 )
258	X-RAY DIFFRACTION	258	chain 'e' and (resid 186 through 208 )
259	X-RAY DIFFRACTION	259	chain 'f' and (resid 2 through 61 )
260	X-RAY DIFFRACTION	260	chain 'f' and (resid 62 through 101 )
261	X-RAY DIFFRACTION	261	chain 'f' and (resid 102 through 121 )
262	X-RAY DIFFRACTION	262	chain 'f' and (resid 122 through 182 )
263	X-RAY DIFFRACTION	263	chain 'g' and (resid 2 through 21 )
264	X-RAY DIFFRACTION	264	chain 'g' and (resid 22 through 41 )
265	X-RAY DIFFRACTION	265	chain 'g' and (resid 42 through 61 )
266	X-RAY DIFFRACTION	266	chain 'g' and (resid 62 through 81 )
267	X-RAY DIFFRACTION	267	chain 'g' and (resid 82 through 101 )
268	X-RAY DIFFRACTION	268	chain 'g' and (resid 102 through 131 )
269	X-RAY DIFFRACTION	269	chain 'g' and (resid 132 through 141 )
270	X-RAY DIFFRACTION	270	chain 'g' and (resid 142 through 151 )
271	X-RAY DIFFRACTION	271	chain 'g' and (resid 152 through 161 )
272	X-RAY DIFFRACTION	272	chain 'g' and (resid 162 through 175 )
273	X-RAY DIFFRACTION	273	chain 'h' and (resid 1 through 20 )
274	X-RAY DIFFRACTION	274	chain 'h' and (resid 21 through 40 )
275	X-RAY DIFFRACTION	275	chain 'h' and (resid 41 through 50 )
276	X-RAY DIFFRACTION	276	chain 'h' and (resid 51 through 60 )
277	X-RAY DIFFRACTION	277	chain 'h' and (resid 61 through 110 )
278	X-RAY DIFFRACTION	278	chain 'i' and (resid 1 through 20 )
279	X-RAY DIFFRACTION	279	chain 'i' and (resid 21 through 50 )
280	X-RAY DIFFRACTION	280	chain 'i' and (resid 51 through 60 )
281	X-RAY DIFFRACTION	281	chain 'i' and (resid 61 through 80 )
282	X-RAY DIFFRACTION	282	chain 'i' and (resid 81 through 90 )
283	X-RAY DIFFRACTION	283	chain 'i' and (resid 91 through 110 )
284	X-RAY DIFFRACTION	284	chain 'i' and (resid 111 through 130 )
285	X-RAY DIFFRACTION	285	chain 'i' and (resid 131 through 140 )
286	X-RAY DIFFRACTION	286	chain 'j' and (resid 1 through 20 )
287	X-RAY DIFFRACTION	287	chain 'j' and (resid 21 through 40 )
288	X-RAY DIFFRACTION	288	chain 'j' and (resid 41 through 60 )
289	X-RAY DIFFRACTION	289	chain 'j' and (resid 61 through 90 )
290	X-RAY DIFFRACTION	290	chain 'j' and (resid 91 through 100 )
291	X-RAY DIFFRACTION	291	chain 'j' and (resid 101 through 110 )
292	X-RAY DIFFRACTION	292	chain 'j' and (resid 111 through 122 )
293	X-RAY DIFFRACTION	293	chain 'k' and (resid 1 through 20 )
294	X-RAY DIFFRACTION	294	chain 'k' and (resid 21 through 60 )
295	X-RAY DIFFRACTION	295	chain 'k' and (resid 61 through 70 )
296	X-RAY DIFFRACTION	296	chain 'k' and (resid 71 through 80 )
297	X-RAY DIFFRACTION	297	chain 'k' and (resid 81 through 100 )
298	X-RAY DIFFRACTION	298	chain 'k' and (resid 101 through 120 )
299	X-RAY DIFFRACTION	299	chain 'k' and (resid 121 through 149 )
300	X-RAY DIFFRACTION	300	chain 'l' and (resid 1 through 40 )
301	X-RAY DIFFRACTION	301	chain 'l' and (resid 41 through 50 )
302	X-RAY DIFFRACTION	302	chain 'l' and (resid 51 through 60 )
303	X-RAY DIFFRACTION	303	chain 'l' and (resid 61 through 80 )
304	X-RAY DIFFRACTION	304	chain 'l' and (resid 81 through 90 )
305	X-RAY DIFFRACTION	305	chain 'l' and (resid 91 through 110 )
306	X-RAY DIFFRACTION	306	chain 'l' and (resid 111 through 130 )
307	X-RAY DIFFRACTION	307	chain 'l' and (resid 131 through 141 )
308	X-RAY DIFFRACTION	308	chain 'm' and (resid 1 through 10 )
309	X-RAY DIFFRACTION	309	chain 'm' and (resid 11 through 30 )
310	X-RAY DIFFRACTION	310	chain 'm' and (resid 31 through 50 )
311	X-RAY DIFFRACTION	311	chain 'm' and (resid 51 through 70 )
312	X-RAY DIFFRACTION	312	chain 'm' and (resid 71 through 80 )
313	X-RAY DIFFRACTION	313	chain 'm' and (resid 81 through 90 )
314	X-RAY DIFFRACTION	314	chain 'm' and (resid 91 through 100 )
315	X-RAY DIFFRACTION	315	chain 'm' and (resid 101 through 110 )
316	X-RAY DIFFRACTION	316	chain 'm' and (resid 111 through 118 )
317	X-RAY DIFFRACTION	317	chain 'n' and (resid 3 through 12 )
318	X-RAY DIFFRACTION	318	chain 'n' and (resid 13 through 42 )
319	X-RAY DIFFRACTION	319	chain 'n' and (resid 43 through 62 )
320	X-RAY DIFFRACTION	320	chain 'n' and (resid 63 through 72 )
321	X-RAY DIFFRACTION	321	chain 'n' and (resid 73 through 92 )
322	X-RAY DIFFRACTION	322	chain 'n' and (resid 93 through 112 )
323	X-RAY DIFFRACTION	323	chain 'o' and (resid 1 through 10 )
324	X-RAY DIFFRACTION	324	chain 'o' and (resid 11 through 20 )
325	X-RAY DIFFRACTION	325	chain 'o' and (resid 21 through 50 )
326	X-RAY DIFFRACTION	326	chain 'o' and (resid 51 through 70 )
327	X-RAY DIFFRACTION	327	chain 'o' and (resid 71 through 90 )
328	X-RAY DIFFRACTION	328	chain 'o' and (resid 91 through 100 )
329	X-RAY DIFFRACTION	329	chain 'o' and (resid 101 through 110 )
330	X-RAY DIFFRACTION	330	chain 'o' and (resid 111 through 120 )
331	X-RAY DIFFRACTION	331	chain 'o' and (resid 121 through 131 )
332	X-RAY DIFFRACTION	332	chain 'p' and (resid 2 through 11 )
333	X-RAY DIFFRACTION	333	chain 'p' and (resid 12 through 31 )
334	X-RAY DIFFRACTION	334	chain 'p' and (resid 32 through 41 )
335	X-RAY DIFFRACTION	335	chain 'p' and (resid 42 through 51 )
336	X-RAY DIFFRACTION	336	chain 'p' and (resid 52 through 61 )
337	X-RAY DIFFRACTION	337	chain 'p' and (resid 62 through 81 )
338	X-RAY DIFFRACTION	338	chain 'p' and (resid 82 through 91 )
339	X-RAY DIFFRACTION	339	chain 'p' and (resid 92 through 106 )
340	X-RAY DIFFRACTION	340	chain 'p' and (resid 107 through 111 )
341	X-RAY DIFFRACTION	341	chain 'p' and (resid 112 through 117 )
342	X-RAY DIFFRACTION	342	chain 'q' and (resid 1 through 20 )
343	X-RAY DIFFRACTION	343	chain 'q' and (resid 21 through 30 )
344	X-RAY DIFFRACTION	344	chain 'q' and (resid 31 through 50 )
345	X-RAY DIFFRACTION	345	chain 'q' and (resid 51 through 60 )
346	X-RAY DIFFRACTION	346	chain 'q' and (resid 61 through 70 )
347	X-RAY DIFFRACTION	347	chain 'q' and (resid 71 through 85 )
348	X-RAY DIFFRACTION	348	chain 'q' and (resid 86 through 95 )
349	X-RAY DIFFRACTION	349	chain 'q' and (resid 96 through 101 )
350	X-RAY DIFFRACTION	350	chain 'r' and (resid 1 through 30 )
351	X-RAY DIFFRACTION	351	chain 'r' and (resid 31 through 60 )
352	X-RAY DIFFRACTION	352	chain 'r' and (resid 61 through 70 )
353	X-RAY DIFFRACTION	353	chain 'r' and (resid 71 through 80 )
354	X-RAY DIFFRACTION	354	chain 'r' and (resid 81 through 105 )
355	X-RAY DIFFRACTION	355	chain 'r' and (resid 106 through 112 )
356	X-RAY DIFFRACTION	356	chain 's' and (resid 1 through 10 )
357	X-RAY DIFFRACTION	357	chain 's' and (resid 11 through 20 )
358	X-RAY DIFFRACTION	358	chain 's' and (resid 21 through 30 )
359	X-RAY DIFFRACTION	359	chain 's' and (resid 31 through 50 )
360	X-RAY DIFFRACTION	360	chain 's' and (resid 51 through 60 )
361	X-RAY DIFFRACTION	361	chain 's' and (resid 61 through 70 )
362	X-RAY DIFFRACTION	362	chain 's' and (resid 71 through 85 )
363	X-RAY DIFFRACTION	363	chain 's' and (resid 86 through 95 )
364	X-RAY DIFFRACTION	364	chain 't' and (resid 1 through 10 )
365	X-RAY DIFFRACTION	365	chain 't' and (resid 11 through 30 )
366	X-RAY DIFFRACTION	366	chain 't' and (resid 31 through 50 )
367	X-RAY DIFFRACTION	367	chain 't' and (resid 51 through 70 )
368	X-RAY DIFFRACTION	368	chain 't' and (resid 71 through 95 )
369	X-RAY DIFFRACTION	369	chain 't' and (resid 96 through 107 )
370	X-RAY DIFFRACTION	370	chain 'u' and (resid 1 through 20 )
371	X-RAY DIFFRACTION	371	chain 'u' and (resid 21 through 60 )
372	X-RAY DIFFRACTION	372	chain 'u' and (resid 61 through 100 )
373	X-RAY DIFFRACTION	373	chain 'u' and (resid 101 through 120 )
374	X-RAY DIFFRACTION	374	chain 'u' and (resid 121 through 140 )
375	X-RAY DIFFRACTION	375	chain 'u' and (resid 141 through 190 )
376	X-RAY DIFFRACTION	376	chain 'u' and (resid 191 through 203 )
377	X-RAY DIFFRACTION	377	chain 'v' and (resid 8 through 17 )
378	X-RAY DIFFRACTION	378	chain 'v' and (resid 18 through 42 )
379	X-RAY DIFFRACTION	379	chain 'v' and (resid 43 through 67 )
380	X-RAY DIFFRACTION	380	chain 'v' and (resid 68 through 72 )
381	X-RAY DIFFRACTION	381	chain 'v' and (resid 73 through 84 )
382	X-RAY DIFFRACTION	382	chain 'w' and (resid 2 through 21 )
383	X-RAY DIFFRACTION	383	chain 'w' and (resid 22 through 41 )
384	X-RAY DIFFRACTION	384	chain 'w' and (resid 42 through 66 )
385	X-RAY DIFFRACTION	385	chain 'w' and (resid 67 through 81 )
386	X-RAY DIFFRACTION	386	chain 'w' and (resid 82 through 98 )
387	X-RAY DIFFRACTION	387	chain 'x' and (resid 1 through 15 )
388	X-RAY DIFFRACTION	388	chain 'x' and (resid 16 through 35 )
389	X-RAY DIFFRACTION	389	chain 'x' and (resid 36 through 50 )
390	X-RAY DIFFRACTION	390	chain 'x' and (resid 51 through 70 )
391	X-RAY DIFFRACTION	391	chain 'y' and (resid 2 through 11 )
392	X-RAY DIFFRACTION	392	chain 'y' and (resid 12 through 31 )
393	X-RAY DIFFRACTION	393	chain 'y' and (resid 32 through 36 )
394	X-RAY DIFFRACTION	394	chain 'y' and (resid 37 through 41 )
395	X-RAY DIFFRACTION	395	chain 'y' and (resid 42 through 51 )
396	X-RAY DIFFRACTION	396	chain 'y' and (resid 52 through 60 )
397	X-RAY DIFFRACTION	397	chain 'z' and (resid 1 through 45 )
398	X-RAY DIFFRACTION	398	chain 'z' and (resid 46 through 69 )
399	X-RAY DIFFRACTION	399	chain '5' and (resid 2 through 16 )
400	X-RAY DIFFRACTION	400	chain '5' and (resid 17 through 31 )
401	X-RAY DIFFRACTION	401	chain '5' and (resid 32 through 41 )
402	X-RAY DIFFRACTION	402	chain '5' and (resid 42 through 51 )
403	X-RAY DIFFRACTION	403	chain '5' and (resid 52 through 60 )
404	X-RAY DIFFRACTION	404	chain '6' and (resid 2 through 11 )
405	X-RAY DIFFRACTION	405	chain '6' and (resid 12 through 21 )
406	X-RAY DIFFRACTION	406	chain '6' and (resid 22 through 26 )
407	X-RAY DIFFRACTION	407	chain '6' and (resid 27 through 31 )
408	X-RAY DIFFRACTION	408	chain '6' and (resid 32 through 41 )
409	X-RAY DIFFRACTION	409	chain '6' and (resid 42 through 51 )
410	X-RAY DIFFRACTION	410	chain '6' and (resid 52 through 54 )
411	X-RAY DIFFRACTION	411	chain '7' and (resid 1 through 5 )
412	X-RAY DIFFRACTION	412	chain '7' and (resid 6 through 15 )
413	X-RAY DIFFRACTION	413	chain '7' and (resid 16 through 20 )
414	X-RAY DIFFRACTION	414	chain '7' and (resid 21 through 25 )
415	X-RAY DIFFRACTION	415	chain '7' and (resid 26 through 30 )
416	X-RAY DIFFRACTION	416	chain '7' and (resid 31 through 35 )
417	X-RAY DIFFRACTION	417	chain '7' and (resid 36 through 40 )
418	X-RAY DIFFRACTION	418	chain '7' and (resid 41 through 45 )
419	X-RAY DIFFRACTION	419	chain '7' and (resid 46 through 48 )
420	X-RAY DIFFRACTION	420	chain '8' and (resid 2 through 11 )
421	X-RAY DIFFRACTION	421	chain '8' and (resid 12 through 26 )
422	X-RAY DIFFRACTION	422	chain '8' and (resid 27 through 36 )
423	X-RAY DIFFRACTION	423	chain '8' and (resid 37 through 41 )
424	X-RAY DIFFRACTION	424	chain '8' and (resid 42 through 51 )
425	X-RAY DIFFRACTION	425	chain '8' and (resid 52 through 56 )
426	X-RAY DIFFRACTION	426	chain '8' and (resid 57 through 61 )
427	X-RAY DIFFRACTION	427	chain '8' and (resid 62 through 65 )
428	X-RAY DIFFRACTION	428	chain '9' and (resid 1 through 10 )
429	X-RAY DIFFRACTION	429	chain '9' and (resid 11 through 15 )
430	X-RAY DIFFRACTION	430	chain '9' and (resid 16 through 20 )
431	X-RAY DIFFRACTION	431	chain '9' and (resid 21 through 30 )
432	X-RAY DIFFRACTION	432	chain '9' and (resid 31 through 37 )