[English] 日本語
Yorodumi- PDB-8p0j: Cryo EM map and model of the vaccinia RNA polymerase intermediate... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 8p0j | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Cryo EM map and model of the vaccinia RNA polymerase intermediate pre-initiation open promoter complex | ||||||||||||||||||||||||
Components |
| ||||||||||||||||||||||||
Keywords | TRANSCRIPTION / RNA polymerase / RNAP / Vaccinia / MPox / PIC / pre-initiation complex | ||||||||||||||||||||||||
| Function / homology | Function and homology informationpolynucleotide 5'-phosphatase activity / inorganic triphosphate phosphatase activity / mRNA 5'-phosphatase / mRNA 5'-triphosphate monophosphatase activity / viral transcription / DNA-directed RNA polymerase complex / DNA-templated transcription termination / virion component / ribonucleoside binding / DNA-directed RNA polymerase ...polynucleotide 5'-phosphatase activity / inorganic triphosphate phosphatase activity / mRNA 5'-phosphatase / mRNA 5'-triphosphate monophosphatase activity / viral transcription / DNA-directed RNA polymerase complex / DNA-templated transcription termination / virion component / ribonucleoside binding / DNA-directed RNA polymerase / DNA-directed RNA polymerase activity / mRNA guanylyltransferase / mRNA guanylyltransferase activity / mRNA (guanine-N7)-methyltransferase / host cell cytoplasm / mRNA 5'-cap (guanine-N7-)-methyltransferase activity / GTP binding / DNA-templated transcription / DNA binding / RNA binding / zinc ion binding / metal ion binding Similarity search - Function | ||||||||||||||||||||||||
| Biological species | Vaccinia virus | ||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 2.39 Å | ||||||||||||||||||||||||
Authors | Grimm, C. / Jungwirth, S. / Fischer, U. | ||||||||||||||||||||||||
| Funding support | 1items
| ||||||||||||||||||||||||
Citation | Journal: To Be PublishedTitle: Cryo EM map and model of the vaccinia RNA polymerase intermediate pre-initiation open promoter complex (CASP target) Authors: Grimm, C. / Jungwirth, S. / Fischer, U. | ||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 8p0j.cif.gz | 2.5 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb8p0j.ent.gz | Display | PDB format | |
| PDBx/mmJSON format | 8p0j.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/p0/8p0j ftp://data.pdbj.org/pub/pdb/validation_reports/p0/8p0j | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 17334MC ![]() 8p0kC ![]() 8p0nC ![]() 9ex9C M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-DNA-directed RNA polymerase ... , 8 types, 8 molecules ABCEFGJS
| #1: Protein | Mass: 146995.703 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG105, RPO147, J6R / Production host: Vaccinia virus / References: UniProt: P20504, DNA-directed RNA polymerase |
|---|---|
| #2: Protein | Mass: 133526.859 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG151, RPO132, A24R / Production host: Vaccinia virus / References: UniProt: P68694, DNA-directed RNA polymerase |
| #3: Protein | Mass: 35430.676 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG156, RPO35, A29L / Production host: Vaccinia virus / References: UniProt: P21087, DNA-directed RNA polymerase |
| #4: Protein | Mass: 21365.740 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: MNQYNVKYLAKILCLKTEIARDPYAVINRNVLLRYTTDIEYNDLVTLITVRHKIDSMKTVFQVFNESSIN YTPVDDDYGEPIIITSYLQKGHNKFPVNFLYIDVVISDLFPSFVRLDTTETNIVNSVLQTGDGKKTLRLP KMLETEIVVKILYRPNIPLKIVRFFRNNMVTGVEIADRSVISVAD Source: (gene. exp.) Vaccinia virus / Gene: OPG103, RPO22, J4R / Production host: Vaccinia virus / References: UniProt: P68608, DNA-directed RNA polymerase |
| #5: Protein | Mass: 19020.088 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG131, RPO19, A5R / Production host: Vaccinia virus / References: UniProt: P68610, DNA-directed RNA polymerase |
| #6: Protein | Mass: 17917.195 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG119, RPO18, D7R / Production host: Vaccinia virus / References: UniProt: P21034, DNA-directed RNA polymerase |
| #8: Protein | Mass: 7299.715 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG090, RPO7, G5.5R / Production host: Vaccinia virus / References: UniProt: P68315, DNA-directed RNA polymerase |
| #12: Protein | Mass: 29834.359 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG066, RPO30, E4L / Production host: Vaccinia virus / References: UniProt: P21082, DNA-directed RNA polymerase |
-Intermediate transcription factor 3 ... , 2 types, 2 molecules HI
| #7: Protein | Mass: 44662.430 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG150, VITF3L, A23R / Production host: Vaccinia virus / References: UniProt: P20998 |
|---|---|
| #14: Protein | Mass: 33618.648 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG134, VITF3S, A8R / Production host: Vaccinia virus / References: UniProt: P20986 |
-MRNA-capping enzyme ... , 2 types, 2 molecules LO
| #9: Protein | Mass: 33396.656 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG124, D12L / Production host: Vaccinia virus / References: UniProt: P20980 |
|---|---|
| #11: Protein | Mass: 96888.758 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Gene: OPG113, D1R / Production host: Vaccinia virusReferences: UniProt: P20979, mRNA 5'-phosphatase, mRNA guanylyltransferase, mRNA (guanine-N7)-methyltransferase |
-DNA chain , 2 types, 2 molecules NT
| #10: DNA chain | Mass: 21587.969 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Production host: synthetic construct (others) |
|---|---|
| #13: DNA chain | Mass: 21675.945 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Vaccinia virus / Production host: synthetic construct (others) |
-Non-polymers , 3 types, 513 molecules 




| #15: Chemical | ChemComp-MG / | ||
|---|---|---|---|
| #16: Chemical | ChemComp-ZN / #17: Water | ChemComp-HOH / | |
-Details
| Has ligand of interest | N |
|---|---|
| Has protein modification | N |
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component |
| ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular weight | Value: 0.75 MDa / Experimental value: YES | ||||||||||||||||||||||||
| Source (natural) |
| ||||||||||||||||||||||||
| Source (recombinant) |
| ||||||||||||||||||||||||
| Buffer solution | pH: 7.5 | ||||||||||||||||||||||||
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES | ||||||||||||||||||||||||
| Specimen support | Grid material: COPPER / Grid type: Quantifoil R1.2/1.3 | ||||||||||||||||||||||||
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2200 nm / Nominal defocus min: 1200 nm |
| Specimen holder | Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER |
| Image recording | Electron dose: 70 e/Å2 / Detector mode: INTEGRATING / Film or detector model: FEI FALCON III (4k x 4k) |
-
Processing
| Software |
| ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EM software |
| ||||||||||||||||||||||||
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| Particle selection | Num. of particles selected: 9318600 | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 2.39 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 1421158 / Symmetry type: POINT | ||||||||||||||||||||||||
| Refinement | Cross valid method: NONE Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2 | ||||||||||||||||||||||||
| Displacement parameters | Biso mean: 55.95 Å2 | ||||||||||||||||||||||||
| Refine LS restraints |
|
Movie
Controller
About Yorodumi



Vaccinia virus
Citation






PDBj











































FIELD EMISSION GUN