[English] 日本語
Yorodumi- PDB-7v0o: Cryo-EM structure of SINV/EEEV in complex with Fab fragment of a ... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7v0o | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Title | Cryo-EM structure of SINV/EEEV in complex with Fab fragment of a moderately/weakly neutralizing human antibody IgG-94 | |||||||||
Components |
| |||||||||
Keywords | VIRUS/IMMUNE SYSTEM / cryo-EM / single particle / virus neutralization / inter-virion crosslink / aggregation / VIRUS-IMMUNE SYSTEM complex | |||||||||
| Function / homology | Function and homology informationtogavirin / T=4 icosahedral viral capsid / symbiont-mediated suppression of host toll-like receptor signaling pathway / host cell cytoplasm / symbiont-mediated suppression of host gene expression / serine-type endopeptidase activity / fusion of virus membrane with host endosome membrane / symbiont entry into host cell / virion attachment to host cell / host cell plasma membrane ...togavirin / T=4 icosahedral viral capsid / symbiont-mediated suppression of host toll-like receptor signaling pathway / host cell cytoplasm / symbiont-mediated suppression of host gene expression / serine-type endopeptidase activity / fusion of virus membrane with host endosome membrane / symbiont entry into host cell / virion attachment to host cell / host cell plasma membrane / host cell nucleus / virion membrane / structural molecule activity / proteolysis / RNA binding Similarity search - Function | |||||||||
| Biological species | ![]() Eastern equine encephalitis virus Homo sapiens (human) | |||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 6.6 Å | |||||||||
Authors | Bandyopadhyay, A. / Klose, T. / Kuhn, R.J. | |||||||||
| Funding support | United States, 2items
| |||||||||
Citation | Journal: Proc Natl Acad Sci U S A / Year: 2023Title: Structural constraints link differences in neutralization potency of human anti-Eastern equine encephalitis virus monoclonal antibodies. Authors: Lauren E Williamson / Abhishek Bandyopadhyay / Kevin Bailey / Devika Sirohi / Thomas Klose / Justin G Julander / Richard J Kuhn / James E Crowe / ![]() Abstract: Selection and development of monoclonal antibody (mAb) therapeutics against pathogenic viruses depends on certain functional characteristics. Neutralization potency, or the half-maximal inhibitory ...Selection and development of monoclonal antibody (mAb) therapeutics against pathogenic viruses depends on certain functional characteristics. Neutralization potency, or the half-maximal inhibitory concentration (IC) values, is an important characteristic of candidate therapeutic antibodies. Structural insights into the bases of neutralization potency differences between antiviral neutralizing mAbs are lacking. In this report, we present cryo-electron microscopy (EM) reconstructions of three anti-Eastern equine encephalitis virus (EEEV) neutralizing human mAbs targeting overlapping epitopes on the E2 protein, with greater than 20-fold differences in their respective IC values. From our structural and biophysical analyses, we identify several constraints that contribute to the observed differences in the neutralization potencies. Cryo-EM reconstructions of EEEV in complex with these Fab fragments reveal structural constraints that dictate intravirion or intervirion cross-linking of glycoprotein spikes by their IgG counterparts as a mechanism of neutralization. Additionally, we describe critical features for the recognition of EEEV by these mAbs including the epitope-paratope interaction surface, occupancy, and kinetic differences in on-rate for binding to the E2 protein. Each constraint contributes to the extent of EEEV inhibition for blockade of virus entry, fusion, and/or egress. These findings provide structural and biophysical insights into the differences in mechanism and neutralization potencies of these antibodies, which help inform rational design principles for candidate vaccines and therapeutic antibodies for all icosahedral viruses. | |||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7v0o.cif.gz | 650.4 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7v0o.ent.gz | 542.3 KB | Display | PDB format |
| PDBx/mmJSON format | 7v0o.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/v0/7v0o ftp://data.pdbj.org/pub/pdb/validation_reports/v0/7v0o | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 26946MC ![]() 7v0nC ![]() 7v0pC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
| Symmetry | Point symmetry: (Schoenflies symbol: I (icosahedral)) |
-
Components
| #1: Protein | Mass: 43628.023 Da / Num. of mol.: 4 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Eastern equine encephalitis virus / Strain: Florida 93-939 / Production host: Mesocricetus auratus (golden hamster) / References: UniProt: Q4QXJ7#2: Antibody | Mass: 18911.242 Da / Num. of mol.: 4 Fragment: Heavy chain variable domain: QVQLVESGGGVVQPGRSLRLSCAASGFVFTNYVMHWVRQAPGKALEWVTLISYDGNNKYYTDSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCARSPHGDVPDYYFDLWGRGTLVTVSS Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Production host: Homo sapiens (human)#3: Antibody | Mass: 17975.100 Da / Num. of mol.: 4 Fragment: Light chain variable domain: DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQHKPGKPPKLLIYKASSLQSGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYRAFGLGTKVEIK Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Production host: Homo sapiens (human)#4: Protein | Mass: 38323.488 Da / Num. of mol.: 4 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Eastern equine encephalitis virus / Strain: Florida 93-939 / Production host: Mesocricetus auratus (golden hamster) / References: UniProt: Q4QXJ7Has protein modification | Y | Sequence details | IgG EEEV-94: Heavy chain variable domain: ...IgG EEEV-94: Heavy chain variable domain: QVQLVESGGG | |
|---|
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Homo sapiens / Type: VIRUS / Entity ID: all / Source: RECOMBINANT | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Molecular weight | Experimental value: NO | |||||||||||||||
| Source (natural) |
| |||||||||||||||
| Source (recombinant) |
| |||||||||||||||
| Details of virus | Empty: NO / Enveloped: YES / Isolate: OTHER / Type: VIRION | |||||||||||||||
| Natural host | Organism: Culiseta melanura | |||||||||||||||
| Virus shell | Name: EEEV / Diameter: 850 nm / Triangulation number (T number): 4 | |||||||||||||||
| Buffer solution | pH: 7.4 | |||||||||||||||
| Specimen | Conc.: 1 mg/ml / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES | |||||||||||||||
| Specimen support | Grid material: COPPER / Grid mesh size: 400 divisions/in. / Grid type: EMS Lacey Carbon | |||||||||||||||
| Vitrification | Cryogen name: ETHANE / Humidity: 80 % / Chamber temperature: 298 K |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 3000 nm / Nominal defocus min: 1000 nm / Cs: 2.7 mm / C2 aperture diameter: 100 µm / Alignment procedure: COMA FREE |
| Specimen holder | Cryogen: NITROGEN / Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER |
| Image recording | Electron dose: 38.33 e/Å2 / Film or detector model: GATAN K3 BIOQUANTUM (6k x 4k) |
| EM imaging optics | Energyfilter name: GIF Bioquantum / Energyfilter slit width: 20 eV |
-
Processing
| Software | Name: UCSF ChimeraX / Version: 1.3/v9 / Classification: model building / URL: https://www.rbvi.ucsf.edu/chimerax/ / Os: Linux / Type: package | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EM software |
| ||||||||||||||||||||||||||||||||
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||||||||||
| Particle selection | Num. of particles selected: 5856 | ||||||||||||||||||||||||||||||||
| Symmetry | Point symmetry: I (icosahedral) | ||||||||||||||||||||||||||||||||
| 3D reconstruction | Resolution: 6.6 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 2858 / Symmetry type: POINT | ||||||||||||||||||||||||||||||||
| Atomic model building | Protocol: RIGID BODY FIT | ||||||||||||||||||||||||||||||||
| Atomic model building | PDB-ID: 6MX4 Accession code: 6MX4 / Source name: PDB / Type: experimental model |
Movie
Controller
About Yorodumi




Eastern equine encephalitis virus
Homo sapiens (human)
United States, 2items
Citation




PDBj





Mesocricetus auratus (golden hamster)
FIELD EMISSION GUN
