+
Open data
-
Basic information
| Entry | Database: PDB / ID: 7m0r | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | Cryo-EM structure of the Sema3A/PlexinA4/Neuropilin 1 complex | ||||||||||||||||||
Components |
| ||||||||||||||||||
Keywords | SIGNALING PROTEIN / plexin / semaphorin / neuropilin / signaling | ||||||||||||||||||
| Function / homology | Function and homology informationneural crest cell migration involved in sympathetic nervous system development / glossopharyngeal nerve morphogenesis / chemorepulsion of branchiomotor axon / regulation of negative chemotaxis / vagus nerve morphogenesis / cranial nerve morphogenesis / Neuropilin interactions with VEGF and VEGFR / cell migration involved in coronary vasculogenesis / anterior commissure morphogenesis / trigeminal nerve morphogenesis ...neural crest cell migration involved in sympathetic nervous system development / glossopharyngeal nerve morphogenesis / chemorepulsion of branchiomotor axon / regulation of negative chemotaxis / vagus nerve morphogenesis / cranial nerve morphogenesis / Neuropilin interactions with VEGF and VEGFR / cell migration involved in coronary vasculogenesis / anterior commissure morphogenesis / trigeminal nerve morphogenesis / Signal transduction by L1 / postganglionic parasympathetic fiber development / facial nerve morphogenesis / regulation of axon extension involved in axon guidance / basal dendrite development / otic placode development / CRMPs in Sema3A signaling / Sema3A PAK dependent Axon repulsion / basal dendrite arborization / sympathetic neuron axon guidance / positive regulation of smooth muscle cell chemotaxis / dichotomous subdivision of terminal units involved in salivary gland branching / retina vasculature morphogenesis in camera-type eye / vestibulocochlear nerve structural organization / dorsal root ganglion morphogenesis / ventral trunk neural crest cell migration / sympathetic neuron projection guidance / facioacoustic ganglion development / trigeminal ganglion development / trigeminal nerve structural organization / semaphorin receptor binding / sensory neuron axon guidance / facial nerve structural organization / negative regulation of axon extension involved in axon guidance / positive regulation of male gonad development / branchiomotor neuron axon guidance / gonadotrophin-releasing hormone neuronal migration to the hypothalamus / protein localization to early endosome / VEGF-activated neuropilin signaling pathway / axon extension involved in axon guidance / renal artery morphogenesis / SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion / maintenance of synapse structure / cerebellar climbing fiber to Purkinje cell synapse / neurofilament / sympathetic neuron projection extension / synaptic target recognition / vascular endothelial growth factor binding / motor neuron migration / negative regulation of epithelial cell migration / regulation of vascular endothelial growth factor receptor signaling pathway / angiogenesis involved in coronary vascular morphogenesis / postsynapse organization / retina vasculature development in camera-type eye / neural crest cell migration involved in autonomic nervous system development / sympathetic ganglion development / axonogenesis involved in innervation / vascular endothelial growth factor receptor activity / positive regulation of axon extension involved in axon guidance / endothelial cell chemotaxis / negative regulation of axon extension / positive regulation of neuron migration / olfactory bulb development / semaphorin receptor complex / neuropilin signaling pathway / neuropilin binding / sympathetic nervous system development / nerve development / positive regulation of platelet-derived growth factor receptor signaling pathway / substrate-dependent cell migration, cell extension / coronary artery morphogenesis / chemorepellent activity / semaphorin receptor activity / commissural neuron axon guidance / cell migration involved in sprouting angiogenesis / outflow tract septum morphogenesis / embryonic heart tube development / axonal fasciculation / motor neuron axon guidance / hepatocyte growth factor receptor signaling pathway / sprouting angiogenesis / positive regulation of vascular associated smooth muscle cell migration / regulation of Cdc42 protein signal transduction / retinal ganglion cell axon guidance / artery morphogenesis / positive regulation of filopodium assembly / positive regulation of cell migration involved in sprouting angiogenesis / cellular response to hepatocyte growth factor stimulus / neural crest cell migration / negative chemotaxis / branching involved in blood vessel morphogenesis / dendrite morphogenesis / growth factor binding / positive chemotaxis / sorting endosome / platelet-derived growth factor receptor signaling pathway / dendrite development / semaphorin-plexin signaling pathway / cellular response to vascular endothelial growth factor stimulus / positive regulation of phosphorylation Similarity search - Function | ||||||||||||||||||
| Biological species | ![]() | ||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.7 Å | ||||||||||||||||||
Authors | Lu, D. / Shang, G. / He, X. / Bai, X. / Zhang, X. | ||||||||||||||||||
| Funding support | United States, 5items
| ||||||||||||||||||
Citation | Journal: Nat Commun / Year: 2021Title: Architecture of the Sema3A/PlexinA4/Neuropilin tripartite complex. Authors: Defen Lu / Guijun Shang / Xiaojing He / Xiao-Chen Bai / Xuewu Zhang / ![]() Abstract: Secreted class 3 semaphorins (Sema3s) form tripartite complexes with the plexin receptor and neuropilin coreceptor, which are both transmembrane proteins that together mediate semaphorin signal for ...Secreted class 3 semaphorins (Sema3s) form tripartite complexes with the plexin receptor and neuropilin coreceptor, which are both transmembrane proteins that together mediate semaphorin signal for neuronal axon guidance and other processes. Despite extensive investigations, the overall architecture of and the molecular interactions in the Sema3/plexin/neuropilin complex are incompletely understood. Here we present the cryo-EM structure of a near intact extracellular region complex of Sema3A, PlexinA4 and Neuropilin 1 (Nrp1) at 3.7 Å resolution. The structure shows a large symmetric 2:2:2 assembly in which each subunit makes multiple interactions with others. The two PlexinA4 molecules in the complex do not interact directly, but their membrane proximal regions are close to each other and poised to promote the formation of the intracellular active dimer for signaling. The structure reveals a previously unknown interface between the a2b1b2 module in Nrp1 and the Sema domain of Sema3A. This interaction places the a2b1b2 module at the top of the complex, far away from the plasma membrane where the transmembrane regions of Nrp1 and PlexinA4 embed. As a result, the region following the a2b1b2 module in Nrp1 must span a large distance to allow the connection to the transmembrane region, suggesting an essential role for the long non-conserved linkers and the MAM domain in neuropilin in the semaphorin/plexin/neuropilin complex. | ||||||||||||||||||
| History |
|
-
Structure visualization
| Movie |
Movie viewer |
|---|---|
| Structure viewer | Molecule: Molmil Jmol/JSmol |
-
Downloads & links
-
Download
| PDBx/mmCIF format | 7m0r.cif.gz | 731.8 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb7m0r.ent.gz | 566.2 KB | Display | PDB format |
| PDBx/mmJSON format | 7m0r.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/m0/7m0r ftp://data.pdbj.org/pub/pdb/validation_reports/m0/7m0r | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 23613MC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
| #1: Protein | Mass: 64132.211 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Homo sapiens (human) / References: UniProt: P97333#2: Protein | Mass: 67931.812 Da / Num. of mol.: 2 / Mutation: A106K,551ARTRA555,731AAQAA735,758ANRA761 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Homo sapiens (human) / References: UniProt: O08665#3: Antibody | Mass: 133253.203 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) ![]() Homo sapiens (human) / References: UniProt: Q80UG2#4: Chemical | ChemComp-CA / Has ligand of interest | N | Has protein modification | Y | Sequence details | The full sequence of Semaphorin-3A is NYANGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSF ...The full sequence of Semaphorin-3A is NYANGKNNVP | |
|---|
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: Ternary complex of Sema3A, PlexinA4 and neuropilin 1 / Type: COMPLEX / Entity ID: #1-#3 / Source: RECOMBINANT |
|---|---|
| Molecular weight | Value: 600 kDa/nm / Experimental value: YES |
| Source (natural) | Organism: ![]() |
| Source (recombinant) | Organism: Homo sapiens (human) |
| Buffer solution | pH: 7.5 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TITAN KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Cs: 2.7 mm / C2 aperture diameter: 100 µm |
| Specimen holder | Cryogen: NITROGEN / Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER |
| Image recording | Electron dose: 50 e/Å2 / Film or detector model: GATAN K3 BIOQUANTUM (6k x 4k) |
-
Processing
| EM software |
| ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | ||||||||||||||||||||||||
| Particle selection | Num. of particles selected: 1453090 | ||||||||||||||||||||||||
| Symmetry | Point symmetry: C2 (2 fold cyclic) | ||||||||||||||||||||||||
| 3D reconstruction | Resolution: 3.7 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 26741 / Symmetry type: POINT |
Movie
Controller
About Yorodumi






United States, 5items
Citation
UCSF Chimera





PDBj







Homo sapiens (human)

