[English] 日本語
Yorodumi
- PDB-7bid: Crystal structure of v31WRAP-T, a 7-bladed designer protein -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 7bid
TitleCrystal structure of v31WRAP-T, a 7-bladed designer protein
Componentsv31WRAP-T
KeywordsDE NOVO PROTEIN / synthetic construct
Function / homology
Function and homology information


protein polyubiquitination / metal ion binding
Similarity search - Function
Borrelia P83100 / : / Borrelia P83/100 protein / AAA-like domain / Quinoprotein alcohol dehydrogenase-like superfamily / WD domain, G-beta repeat / G-protein beta WD-40 repeat / WD40 repeat, conserved site / Trp-Asp (WD) repeats signature. / Trp-Asp (WD) repeats profile. ...Borrelia P83100 / : / Borrelia P83/100 protein / AAA-like domain / Quinoprotein alcohol dehydrogenase-like superfamily / WD domain, G-beta repeat / G-protein beta WD-40 repeat / WD40 repeat, conserved site / Trp-Asp (WD) repeats signature. / Trp-Asp (WD) repeats profile. / Trp-Asp (WD) repeats circular profile. / WD40 repeats / WD40 repeat / WD40-repeat-containing domain superfamily / WD40/YVTN repeat-like-containing domain superfamily / P-loop containing nucleoside triphosphate hydrolase
Similarity search - Domain/homology
WD-40 repeat protein
Similarity search - Component
Biological speciessynthetic construct (others)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.8 Å
AuthorsLaier, I. / Mylemans, B. / Lee, X.Y. / Voet, A.R.D.
Funding support Belgium, 4items
OrganizationGrant numberCountry
Research Foundation - Flanders (FWO)G0E4717N Belgium
Research Foundation - Flanders (FWO)G0F9316N Belgium
Research Foundation - Flanders (FWO)G051917N Belgium
Research Foundation - Flanders (FWO)GBM-D3229-ASP/17 Belgium
CitationJournal: Sci Rep / Year: 2021
Title: Structure and stability of the designer protein WRAP-T and its permutants.
Authors: Mylemans, B. / Lee, X.Y. / Laier, I. / Helsen, C. / Voet, A.R.D.
History
DepositionJan 12, 2021Deposition site: PDBE / Processing site: PDBE
Revision 1.0Sep 22, 2021Provider: repository / Type: Initial release
Revision 1.1Oct 6, 2021Group: Data collection / Database references / Structure summary
Category: citation / citation_author ...citation / citation_author / pdbx_contact_author / pdbx_database_proc
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_PubMed / _citation.title
Revision 1.2Jan 31, 2024Group: Data collection / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / diffrn_source / pdbx_initial_refinement_model
Item: _diffrn_source.pdbx_synchrotron_site

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: v31WRAP-T


Theoretical massNumber of molelcules
Total (without water)30,3541
Polymers30,3541
Non-polymers00
Water5,873326
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area0 Å2
ΔGint0 kcal/mol
Surface area10790 Å2
MethodPISA
Unit cell
Length a, b, c (Å)44.636, 61.396, 99.410
Angle α, β, γ (deg.)90.000, 90.000, 90.000
Int Tables number19
Space group name H-MP212121
Space group name HallP2ac2ab
Symmetry operation#1: x,y,z
#2: x+1/2,-y+1/2,-z
#3: -x,y+1/2,-z+1/2
#4: -x+1/2,-y,z+1/2

-
Components

#1: Protein v31WRAP-T


Mass: 30354.143 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: ...Details: GSHMQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVTGVAFSPDG
Source: (gene. exp.) synthetic construct (others) / Production host: Escherichia coli (E. coli) / References: UniProt: B2J0I0
#2: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 326 / Source method: isolated from a natural source / Formula: H2O

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.28 Å3/Da / Density % sol: 46.03 %
Crystal growTemperature: 293.15 K / Method: vapor diffusion, sitting drop / Details: 0.2M Ammonium formate 20% (w/v) PEG 3350

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: Diamond / Beamline: I04 / Wavelength: 0.9795 Å
DetectorType: DECTRIS EIGER2 X 16M / Detector: PIXEL / Date: May 18, 2019
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.9795 Å / Relative weight: 1
ReflectionResolution: 1.8→44.64 Å / Num. obs: 26008 / % possible obs: 99.8 % / Redundancy: 8.6 % / Biso Wilson estimate: 11.32 Å2 / CC1/2: 1 / Rmerge(I) obs: 0.025 / Rpim(I) all: 0.01 / Χ2: 0.89 / Net I/σ(I): 55.4
Reflection shellResolution: 1.8→1.84 Å / Redundancy: 5 % / Rmerge(I) obs: 0.042 / Mean I/σ(I) obs: 21.6 / Num. unique obs: 7304 / CC1/2: 0.998 / Rpim(I) all: 0.019 / Χ2: 0.5 / % possible all: 97.3

-
Processing

Software
NameVersionClassification
PHENIX1.17.1_3660refinement
XDSdata reduction
Aimlessdata scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 2ymu
Resolution: 1.8→40.72 Å / SU ML: 0.1424 / Cross valid method: FREE R-VALUE / σ(F): 1.5 / Phase error: 16.9653
Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
RfactorNum. reflection% reflection
Rfree0.1827 1318 5.08 %
Rwork0.1476 24635 -
obs0.1494 25953 99.7 %
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL
Displacement parametersBiso mean: 14.81 Å2
Refinement stepCycle: LAST / Resolution: 1.8→40.72 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms2069 0 0 326 2395
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.01582200
X-RAY DIFFRACTIONf_angle_d1.33933022
X-RAY DIFFRACTIONf_chiral_restr0.1014364
X-RAY DIFFRACTIONf_plane_restr0.0089397
X-RAY DIFFRACTIONf_dihedral_angle_d15.6911761
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
1.8-1.870.22071570.1512612X-RAY DIFFRACTION97.81
1.87-1.960.24881490.1542682X-RAY DIFFRACTION99.86
1.96-2.060.18441510.14512696X-RAY DIFFRACTION99.89
2.06-2.190.19511450.1472720X-RAY DIFFRACTION100
2.19-2.360.19651500.14782727X-RAY DIFFRACTION100
2.36-2.60.2011410.15412727X-RAY DIFFRACTION100
2.6-2.970.21841230.15912772X-RAY DIFFRACTION100
2.97-3.740.13911510.13912779X-RAY DIFFRACTION100
3.74-40.720.15311510.14332920X-RAY DIFFRACTION99.74

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more