[English] 日本語
Yorodumi- PDB-11hk: SARS-CoV-2 spike S2 trimer stabilized in the early fusion interme... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 11hk | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | SARS-CoV-2 spike S2 trimer stabilized in the early fusion intermediate conformation (E-FICs-v3) bound to the VN01H1 Fab (Fab local refinement) | ||||||||||||||||||||||||
Components |
| ||||||||||||||||||||||||
Keywords | VIRAL PROTEIN / S2prime / coronavirus / SARS-CoV-2 / spike / fusion / entry / antiviral / Structural Genomics / Seattle Structural Genomics Center for Infectious Disease / SSGCID / VIRAL PROTEIN-HYDROLASE complex / VN01H1 | ||||||||||||||||||||||||
| Function / homology | Function and homology informationSUMO is conjugated to E1 (UBA2:SAE1) / SUMOylation of nuclear envelope proteins / SUMO is transferred from E1 to E2 (UBE2I, UBC9) / SUMO is proteolytically processed / SUMOylation of SUMOylation proteins / SUMOylation of transcription factors / SUMOylation of transcription cofactors / Postmitotic nuclear pore complex (NPC) reformation / septin ring / SUMOylation of DNA damage response and repair proteins ...SUMO is conjugated to E1 (UBA2:SAE1) / SUMOylation of nuclear envelope proteins / SUMO is transferred from E1 to E2 (UBE2I, UBC9) / SUMO is proteolytically processed / SUMOylation of SUMOylation proteins / SUMOylation of transcription factors / SUMOylation of transcription cofactors / Postmitotic nuclear pore complex (NPC) reformation / septin ring / SUMOylation of DNA damage response and repair proteins / Transcriptional and post-translational regulation of MITF-M expression and activity / SUMOylation of RNA binding proteins / SUMOylation of DNA replication proteins / SUMOylation of chromatin organization proteins / ubiquitin-like protein ligase binding / protein sumoylation / condensed nuclear chromosome / protein tag activity / symbiont-mediated disruption of host tissue / Maturation of spike protein / Translation of Structural Proteins / Virion Assembly and Release / host cell surface / Lectin pathway of complement activation / host extracellular region / symbiont-mediated-mediated suppression of host tetherin activity / Induction of Cell-Cell Fusion / structural constituent of virion / positive regulation of viral entry into host cell / Initial triggering of complement / membrane fusion / host cell endoplasmic reticulum-Golgi intermediate compartment membrane / Attachment and Entry / entry receptor-mediated virion attachment to host cell / receptor-mediated virion attachment to host cell / host cell surface receptor binding / symbiont-mediated suppression of host innate immune response / endocytosis involved in viral entry into host cell / receptor ligand activity / fusion of virus membrane with host plasma membrane / fusion of virus membrane with host endosome membrane / viral envelope / symbiont entry into host cell / virion attachment to host cell / host cell plasma membrane / SARS-CoV-2 activates/modulates innate and adaptive immune responses / virion membrane / membrane / identical protein binding / nucleus / plasma membrane Similarity search - Function | ||||||||||||||||||||||||
| Biological species | ![]() ![]() Homo sapiens (human) | ||||||||||||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 2.7 Å | ||||||||||||||||||||||||
Authors | McCallum, M. / Seattle Structural Genomics Center for Infectious Disease (SSGCID) / Veesler, D. | ||||||||||||||||||||||||
| Funding support | United States, 1items
| ||||||||||||||||||||||||
Citation | Journal: Nat Struct Mol Biol / Year: 2026Title: TMPRSS2-mediated coronavirus spike activation and inhibition. Authors: Matthew McCallum / James Brett Case / Jack T Brown / Young-Jun Park / Jimin Lee / Emmajay Sutherland / Anupriya Aggarwal / Cecily Gibson / Florian A Lempp / Cameron Stewart / M Alejandra ...Authors: Matthew McCallum / James Brett Case / Jack T Brown / Young-Jun Park / Jimin Lee / Emmajay Sutherland / Anupriya Aggarwal / Cecily Gibson / Florian A Lempp / Cameron Stewart / M Alejandra Tortorici / Shilpa Sanapala / Jun Siong Low / Daniel Asarnow / Dana Bohan / Exequiel Dellota / Benjamin Merz / Bhavna Chawla / Swagata Kar / Antonio Lanzavecchia / Federica Sallusto / Nicholas M Riley / Stuart Turville / Lisa Purcell / Michael S Diamond / David Veesler / ![]() Abstract: The protease TMPRSS2 facilitates coronavirus infections, yet its mechanism of viral glycoprotein recognition remains unclear. Here we show that, following ACE2 engagement of the SARS-CoV-2 spike (S) ...The protease TMPRSS2 facilitates coronavirus infections, yet its mechanism of viral glycoprotein recognition remains unclear. Here we show that, following ACE2 engagement of the SARS-CoV-2 spike (S) inducing the early fusion intermediate conformation (E-FIC), TMPRSS2 cleaves the R815 S' site and promotes fusogenic conformational changes leading to viral entry. We unveil TMPRSS2 recognition of S', identify key residues modulating binding specificity and demonstrate that S' site-directed broadly neutralizing antibodies target E-FIC and inhibit viral entry by blocking TMPRSS2 access. We computationally designed stabilized E-FIC as a vaccine candidate, overcoming the transient nature of this state. We describe a TMPRSS2-directed monoclonal antibody inhibiting several coronaviruses, including SARS-CoV-2 variants and protecting mice against SARS-CoV-2 challenge. These results outline the mechanistic role of TMPRSS2 and S' site-directed antibodies in coronavirus entry. | ||||||||||||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 11hk.cif.gz | 281.8 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb11hk.ent.gz | 198.2 KB | Display | PDB format |
| PDBx/mmJSON format | 11hk.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/1h/11hk ftp://data.pdbj.org/pub/pdb/validation_reports/1h/11hk | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 75694MC ![]() 11hlC ![]() 11hnC ![]() 11hwC ![]() 9opqC ![]() 9oprC ![]() 9yyuC ![]() 9yyvC ![]() 9z3jC ![]() 9z3kC C: citing same article ( M: map data used to model this data |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
| #1: Protein | Mass: 67787.180 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Details: E-FICS-v3 encodes an azurocidin signal peptide, a serine residue, a SUMO tag (Uniprot: Q12306 1-94), an enterokinase cleavage site, a TGTGS linker, redesigned equine infectious anemia virus ...Details: E-FICS-v3 encodes an azurocidin signal peptide, a serine residue, a SUMO tag (Uniprot: Q12306 1-94), an enterokinase cleavage site, a TGTGS linker, redesigned equine infectious anemia virus gp45 HR1 (QSNAESVQNHTFEVLNNTIRALELILRKLEILYEMILQLHE), a designed EVEAIQKAI linker, SARS-CoV-2 S residues 914-1131 (corresponding roughly to the HR1-CH-beta-H-CD region and with the D985A substitution), a threonine residue, SARS-CoV-2 S residues 703-833 (corresponding roughly to the beta-UH-SCR region), a designed linker (TIDKEK), redesigned equine infectious anemia virus gp45 HR2 (WKEWRKEMENLTKEIKETLEEARKTLKQAEETFKTPSSG), a GT linker, a second enterokinase cleavage site, a modified AVI tag (TGSLNDIFEAQKIEWHE), a QGS linker, and a C-terminal octahistidine tag Source: (gene. exp.) ![]() ![]() Gene: SMT3, YDR510W, D9719.15, S, 2 / Production host: Homo sapiens (human) / References: UniProt: Q12306, UniProt: P0DTC2#2: Antibody | Mass: 24131.090 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Production host: Homo sapiens (human)#3: Antibody | Mass: 23413.924 Da / Num. of mol.: 3 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Production host: Homo sapiens (human)#4: Sugar | ChemComp-NAG / #5: Water | ChemComp-HOH / | Has ligand of interest | N | Has protein modification | Y | |
|---|
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: SARS-CoV-2 S2 trimer stabilized in the early fusion intermediate conformation by circular permutation and clamping by gp45m (E-FICs-v3) bound to the VN01H1 Fab Type: COMPLEX / Entity ID: #1-#3 / Source: RECOMBINANT |
|---|---|
| Molecular weight | Experimental value: NO |
| Source (natural) | Organism: Homo sapiens (human) |
| Source (recombinant) | Organism: Homo sapiens (human) |
| Buffer solution | pH: 7.5 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: TFS KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 2700 nm / Nominal defocus min: 200 nm |
| Image recording | Electron dose: 50 e/Å2 / Film or detector model: GATAN K3 (6k x 4k) |
-
Processing
| EM software |
| |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | |||||||||
| 3D reconstruction | Resolution: 2.7 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 121952 / Symmetry type: POINT |
Movie
Controller
About Yorodumi





Homo sapiens (human)
United States, 1items
Citation























PDBj











FIELD EMISSION GUN