eF-site ID 6cug-E
PDB Code 6cug
Chain E

click to enlarge
Title Crystal structure of BC8B TCR-CD1b-PC complex
Classification IMMUNE SYSTEM
Compound T-cell surface glycoprotein CD1b
Source (6CUG)
Sequence E:  AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGM
GLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESA
APSQTSVYFCASSMPGLRSSYEQYFGPGTRLTVTEDLKNV
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWW
VNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATF
WQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
GRAD
Description (1)  T-cell surface glycoprotein CD1b, Beta-2-microglobulin, T-cell receptor alpha variable TRAV9-2 - BC8B TCR, T-cell receptor beta variable TRBV6-2 - BC8B TCR


Functional site

1) chain E
residue 2
type
ligand
sequence A
description binding site for residue CL E 301
source : AC3

2) chain E
residue 3
type
ligand
sequence G
description binding site for residue CL E 301
source : AC3

3) chain E
residue 26
type
ligand
sequence D
description binding site for residue CL E 301
source : AC3

4) chain E
residue 98
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence L
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6cug_D_301


Display surface

Download
Links