eF-site ID 6cug-D
PDB Code 6cug
Chain D

click to enlarge
Title Crystal structure of BC8B TCR-CD1b-PC complex
Classification IMMUNE SYSTEM
Compound T-cell surface glycoprotein CD1b
Source (6CUG)
Sequence D:  GNSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYP
GEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSV
QVSDSAVYFCALTPSGGYQKVTFGTGTKLQVIPNIQNPDP
AVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDK
CVLDMRSMDFKSNSAVAWSNKDFACA
Description (1)  T-cell surface glycoprotein CD1b, Beta-2-microglobulin, T-cell receptor alpha variable TRAV9-2 - BC8B TCR, T-cell receptor beta variable TRBV6-2 - BC8B TCR


Functional site

1) chain D
residue 28
type
ligand
sequence T
description binding site for residue POV D 301
source : AC2

2) chain D
residue 29
type
ligand
sequence G
description binding site for residue POV D 301
source : AC2

3) chain D
residue 30
type
ligand
sequence Y
description binding site for residue POV D 301
source : AC2

4) chain D
residue 31
type
ligand
sequence P
description binding site for residue POV D 301
source : AC2

5) chain D
residue 94
type
ligand
sequence P
description binding site for residue POV D 301
source : AC2

6) chain D
residue 95
type
ligand
sequence S
description binding site for residue POV D 301
source : AC2

7) chain D
residue 98
type
ligand
sequence Y
description binding site for residue POV D 301
source : AC2

8) chain D
residue 28-31
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence TGYP
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6cug_D_301

9) chain D
residue 94-96
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence PSG
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6cug_D_301

10) chain D
residue 98-99
type binding
ligand POV: (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
sequence YQ
description (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate binding site
source pdb_hetatom : POV_6cug_D_301


Display surface

Download
Links