eF-site ID 5zi0-D
PDB Code 5zi0
Chain D

click to enlarge
Title Ketoreductase LbCR mutant - M8
Classification OXIDOREDUCTASE
Compound 3-oxoacyl-acyl carrier protein reductase
Source (Q03TH6_LACBA)
Sequence D:  TDRLKDKVAIITGGVAGIGLGIAECYVREGAKVVVTANHN
VDGGRAAVAKFGDDVSLFVQQDVSKEADWQKVIDATIAKF
GRVDILVNNAGIGGVNTAIEDLDLADWQKVIDVNLTANFL
GEKAAIKAMKQTADAKGSIINVSSVAGLVGLPIDPAYSAS
KGGSRLLTHATALNLAQRGIDIRVNSVHPGWIDTSIIPED
LRKQIIATIPVGHMGQPQDIGEVCVYLGSDESRFANGAEF
TVDGGQRA
Description (1)  3-oxoacyl-acyl carrier protein reductase

Display surface

Download
Links