eF-site ID 5cz6-F
PDB Code 5cz6
Chain F

click to enlarge
Title Yeast 20S proteasome beta5-T1A mutant in complex with Syringolin A, propeptide expressed in trans
Classification HYDROLASE/HYDROLASE INHIBITOR
Compound Proteasome subunit alpha type-2
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c);
Sequence F:  TGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDG
VVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDG
RHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTL
YNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAAT
GKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHE
DNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQK
EIN
Description (1)  PROTEASOME SUBUNIT ALPHA TYPE-2 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-3 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-4 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-5 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-6 (E.C.3.4.25.1), PROBABLE PROTEASOME SUBUNIT ALPHA TYPE-7 (E.C.3.4.25.1), PROTEASOME SUBUNIT ALPHA TYPE-1 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-2 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-3 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-4 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-5 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-6 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-7 (E.C.3.4.25.1), PROTEASOME SUBUNIT BETA TYPE-1 (E.C.3.4.25.1), 3-PYRIDIN-4-YL-2,4-DIHYDRO-INDENO[1,2-.C.]PYRAZOLE

Display surface

Download
Links