eF-site ID 4y7r-A PDB Code 4y7r Chain A click to enlarge Title Crystal structure of WDR5 in complex with MYC MbIIIb peptide Classification DNA BINDING PROTEIN Compound WD repeat-containing protein 5 Source Homo sapiens (Human) (4Y7R) Sequence A:  VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKT LKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL AATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTG GKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACH PTENIIASAALENDKTIKLWKSDC Description Functional site 1) chain A residue 49 type sequence S description binding site for residue TRS A 401 source : AC1 2) chain A residue 91 type sequence S description binding site for residue TRS A 401 source : AC1 3) chain A residue 133 type sequence F description binding site for residue TRS A 401 source : AC1 4) chain A residue 261 type sequence C description binding site for residue TRS A 401 source : AC1 5) chain A residue 263 type sequence F description binding site for residue TRS A 401 source : AC1 6) chain A residue 305 type sequence I description binding site for residue TRS A 401 source : AC1 7) chain A residue 260 type sequence Y description binding site for residue EDO A 402 source : AC2 8) chain A residue 302 type sequence D description binding site for residue EDO A 402 source : AC2 9) chain A residue 112 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 107 type SITE sequence D description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 133 type SITE sequence F description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 263 type SITE sequence F description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 322 type SITE sequence E description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 102-116 type prosite sequence LVSASDDKTLKIWDV description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 16) chain A residue 144-158 type prosite sequence IVSGSFDESVRIWDV description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 17) chain A residue 186-200 type prosite sequence IVSSSYDGLCRIWDT description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 18) chain A residue 274-288 type prosite sequence IVSGSEDNLVYIWNL description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678

Display surface Download Links