eF-site ID 4ns0-A PDB Code 4ns0 Chain A click to enlarge Title The C2A domain of Rabphilin 3A in complex with PI(4,5)P2 Classification PROTEIN TRANSPORT Compound Rabphilin-3A Source Rattus norvegicus (Rat) (RP3A_RAT) Sequence A:  TLGALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPY VKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEE DMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKN FNICLERV Description Functional site 1) chain A residue 410 type sequence K description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 2) chain A residue 411 type sequence P description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 3) chain A residue 412 type sequence M description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 4) chain A residue 413 type sequence D description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 5) chain A residue 414 type sequence S description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 6) chain A residue 421 type sequence Y description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 7) chain A residue 423 type sequence K description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 8) chain A residue 435 type sequence K description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 9) chain A residue 436 type sequence L description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 10) chain A residue 437 type sequence R description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 11) chain A residue 475 type sequence E description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 12) chain A residue 479 type sequence G description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 13) chain A residue 480 type sequence H description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 14) chain A residue 481 type sequence N description BINDING SITE FOR RESIDUE PIO A 601 source : AC1 15) chain A residue 423 type sequence K description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 16) chain A residue 442 type sequence R description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 17) chain A residue 469 type sequence R description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 18) chain A residue 471 type sequence S description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 19) chain A residue 412 type BINDING sequence M description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 413 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 419 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 474 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 475 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 476 type BINDING sequence D description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 482 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P47708 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links