eF-site ID 4hw3-A PDB Code 4hw3 Chain A click to enlarge Title Discovery of potent Mcl-1 inhibitors using fragment-based methods and structure-based design Classification APOPTOSIS/INHIBITOR Compound Induced myeloid leukemia cell differentiation protein Mcl-1 Source Homo sapiens (Human) (MCL1_HUMAN) Sequence A:  GDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKAL ETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM IHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPL AESITDVLVRTKRDWLVKQRGWDGFVEFFH Description Functional site 1) chain A residue 228 type sequence F description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 2) chain A residue 246 type sequence L description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 3) chain A residue 253 type sequence V description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 4) chain A residue 263 type sequence R description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 5) chain A residue 266 type sequence T description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 6) chain A residue 267 type sequence L description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 7) chain A residue 270 type sequence F description BINDING SITE FOR RESIDUE 19G A 400 source : AC1 8) chain A residue 308 type sequence K description BINDING SITE FOR RESIDUE 19G C 400 source : AC3 9) chain A residue 258 type sequence V description BINDING SITE FOR RESIDUE 19G E 400 source : AC5 10) chain A residue 253-272 type prosite sequence VFSDGVTNWGRIVTLISFGA description BH1 Apoptosis regulator, Bcl-2 family BH1 motif signature. VFsDGvtNWGRIVTLIsFGA source prosite : PS01080 11) chain A residue 305-316 type prosite sequence WLVKQRGWDGFV description BH2 Apoptosis regulator, Bcl-2 family BH2 motif signature. WLvkqRGWDgFV source prosite : PS01258 12) chain A residue 209-223 type prosite sequence ALETLRRVGDGVQRN description BH3 Apoptosis regulator, Bcl-2 family BH3 motif signature. AletLRrVGDGVQRN source prosite : PS01259 13) chain A residue 194 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1 14) chain A residue 197 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI1

Display surface Download Links