eF-site ID 4fao-k
PDB Code 4fao
Chain k

click to enlarge
Title Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex
Classification SIGNALING PROTEIN/SIGNALING PROTEIN
Compound Growth/differentiation factor 2
Source (AVR2B_HUMAN)
Sequence k:  RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNS
SGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEG
NFCNERFTHLP
Description (1)  Growth/differentiation factor 2, Serine/threonine-protein kinase receptor R3 (E.C.2.7.11.30), Activin receptor type-2B (E.C.2.7.11.30)

Display surface

Download
Links