eF-site ID 4fao-k
PDB Code 4fao
Chain k

click to enlarge
Title Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex
Classification SIGNALING PROTEIN/SIGNALING PROTEIN
Compound Growth/differentiation factor 2
Source Homo sapiens (Human) (AVR2B_HUMAN)
Sequence k:  RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNS
SGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEG
NFCNERFTHLP
Description (1)  Growth/differentiation factor 2, Serine/threonine-protein kinase receptor R3 (E.C.2.7.11.30), Activin receptor type-2B (E.C.2.7.11.30)


Functional site

1) chain k
residue 13
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAG X 201
source : BC9

2) chain k
residue 23
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG X 201
source : BC9

3) chain k
residue 24
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG X 201
source : BC9

4) chain k
residue 28
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAG X 201
source : BC9

5) chain k
residue 30
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAG X 201
source : BC9

6) chain k
residue 24
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG k 201
source : CC8

7) chain k
residue 47
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG k 202
source : CC9

8) chain k
residue 49
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAG k 202
source : CC9

9) chain k
residue 50
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAG k 202
source : CC9

10) chain k
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NAG k 202
source : CC9

11) chain k
residue 17
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NA k 203
source : DC1

12) chain k
residue 46
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NA k 203
source : DC1

13) chain k
residue 22-24
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence RTN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_201

14) chain k
residue 13
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_X_201

15) chain k
residue 23-24
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TN
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_X_201

16) chain k
residue 28-30
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence LER
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_X_201

17) chain k
residue 45
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202

18) chain k
residue 47
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202

19) chain k
residue 49-50
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence SG
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202

20) chain k
residue 52
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence I
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202

21) chain k
residue 82
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Y
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202

22) chain k
residue 96-97
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence TH
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4fao_k_202


Display surface

Download
Links