eF-site ID 4bxf-ABCD
PDB Code 4bxf
Chain A, B, C, D

click to enlarge
Title 60S ribosomal protein L27A histidine hydroxylase (MINA53 Y209C) in complex with MN(II), 2-oxoglutarate (2OG) and 60S ribosomal protein L27A (RPL27A G37C) peptide fragment
Classification OXIDOREDUCTASE/TRANSLATION
Compound BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE MINA
Source (RL27A_HUMAN)
Sequence A:  PSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRD
DPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGK
KKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWR
IQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQ
LEGEKHWRLYHPTVPLARECSVEAEERIGRPVHEFMLKPG
DLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLL
DTISGLVFDTAKEDVELRTGIPRQLLLQVESTTVATRRLS
GFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAE
LSTPGGKLPRLDSVVRLQFKDHIVLTVLPAQEKMVYIYHS
LKNSRETHMMGNEFHGLRFPLSHLDALKQIWNSPAISVKD
LKLTTDEEKESLVLSLWTECLIQVV
B:  SALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKK
KVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWRI
QEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQL
EGEKHWRLYHPTVPLARECSVEAEERIGRPVHEFMLKPGD
LLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLD
TISGLVFDTAKEDVELRTGIPRQLLLQVESTTVATRRLSG
FLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL
STPGGKLPRLDSVVRLQFKDHIVLTVLPQEKMVYIYHSLK
NSRETHMMTEFHGLRFPLSHLDALKQIWNSPAISVKDLKL
TTDEEKESLVLSLWTECLIQVV
C:  GCLHHHRIN
D:  GCLHHHRI
Description (1)  BIFUNCTIONAL LYSINE-SPECIFIC DEMETHYLASE AND HISTIDYL-HYDROXYLASE MINA (E.C.1.14.11.-), 60S RIBOSOMAL PROTEIN L27A


Functional site

1) chain A
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 601
source : AC1

2) chain A
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN A 601
source : AC1

3) chain A
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 601
source : AC1

4) chain A
residue 167
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

5) chain A
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

6) chain A
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

7) chain A
residue 194
type
ligand
sequence K
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

8) chain A
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

9) chain A
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

10) chain A
residue 255
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AKG A 901
source : AC2

11) chain B
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

12) chain B
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

13) chain B
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 601
source : AC3

14) chain B
residue 179
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

15) chain B
residue 181
type
ligand
sequence D
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

16) chain B
residue 194
type
ligand
sequence K
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

17) chain B
residue 240
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

18) chain B
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

19) chain B
residue 255
type
ligand
sequence T
description BINDING SITE FOR RESIDUE AKG B 901
source : AC4

20) chain A
residue 167
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence Y
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

21) chain A
residue 169
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

22) chain A
residue 175-176
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence GL
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

23) chain A
residue 179
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

24) chain A
residue 181
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence D
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

25) chain A
residue 187
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence I
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

26) chain A
residue 194
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence K
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

27) chain A
residue 196
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence W
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

28) chain A
residue 240
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

29) chain A
residue 242
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

30) chain A
residue 253
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

31) chain A
residue 255
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

32) chain C
residue 39
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_A_901

33) chain B
residue 134
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

34) chain B
residue 167
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence Y
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

35) chain B
residue 169
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

36) chain B
residue 175-176
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence GL
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

37) chain B
residue 179
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

38) chain B
residue 181
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence D
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

39) chain B
residue 187
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence I
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

40) chain B
residue 194
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence K
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

41) chain B
residue 196
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence W
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

42) chain B
residue 234
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence F
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

43) chain B
residue 240
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

44) chain B
residue 242
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence A
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

45) chain B
residue 253
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

46) chain B
residue 255
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence T
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901

47) chain D
residue 39
type binding
ligand AKG: 2-OXOGLUTARIC ACID
sequence H
description 2-OXOGLUTARIC ACID binding site
source pdb_hetatom : AKG_4bxf_B_901


Display surface

Download
Links