eF-site ID 4aq3-A PDB Code 4aq3 Chain A click to enlarge Title HUMAN BCL-2 WITH PHENYLACYLSULFONAMIDE INHIBITOR Classification APOPTOSIS Compound APOPTOSIS REGULATOR BCL-2, BCL-2-LIKE PROTEIN 1 Source Homo sapiens (Human) (BCLX_HUMAN) Sequence A:  YDNREIVMKYIHYKLSQRGYEWDVVHLALRQAGDDFSRRY RGDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIV AFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTW IQDNGGWDAFVELYG Description Functional site 1) chain A residue 67 type sequence Y description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 2) chain A residue 70 type sequence D description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 3) chain A residue 74 type sequence M description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 4) chain A residue 95 type sequence E description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 5) chain A residue 96 type sequence L description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 6) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE 398 A 1163 source : AC1 7) chain A residue 82 type sequence P description BINDING SITE FOR RESIDUE 398 D 1163 source : AC4 8) chain A residue 58 type sequence Q description BINDING SITE FOR RESIDUE 398 E 1163 source : AC5 9) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE 398 E 1163 source : AC5 10) chain A residue 161 type sequence Y description BINDING SITE FOR RESIDUE 398 E 1163 source : AC5 11) chain A residue 162 type sequence G description BINDING SITE FOR RESIDUE 398 E 1163 source : AC5 12) chain A residue 96-114 type prosite sequence LFRDGVNWGRIVAFFEFGG description BH1 Apoptosis regulator, Bcl-2 family BH1 motif signature. LFrDGv.NWGRIVAFFeFGG source prosite : PS01080 13) chain A residue 147-158 type prosite sequence WIQDNGGWDAFV description BH2 Apoptosis regulator, Bcl-2 family BH2 motif signature. WIqdnGGWDaFV source prosite : PS01258 14) chain A residue 52-66 type prosite sequence VHLALRQAGDDFSRR description BH3 Apoptosis regulator, Bcl-2 family BH3 motif signature. VhlaLRqAGDDFSRR source prosite : PS01259 15) chain A residue 10-30 type prosite sequence DNREIVMKYIHYKLSQRGYEW description BH4_1 Apoptosis regulator, Bcl-2 family BH4 motif signature. DNREIVmKYIHYKLSQRGYeW source prosite : PS01260 16) chain A residue 54 type MOD_RES sequence L description Phosphothreonine; by MAPK8 => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 55 type MOD_RES sequence A description Phosphoserine; by MAPK8 and PKC => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 72 type MOD_RES sequence A description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:18570871 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links