eF-site ID 3c4b-A PDB Code 3c4b Chain A click to enlarge Title Structure of RNaseIIIb and dsRNA binding domains of mouse Dicer Classification HYDROLASE Compound Endoribonuclease Dicer Source Mus musculus (Mouse) (DICER_MOUSE) Sequence A:  DAEKTLNHLISGFETFEKKINYRFKNKAYLLQAFTHASYH YNTITDXYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLT DLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFV KFQLEKNEEDIEVPKAXGDIFESLAGAIYXDSGXSLEVVW QVYYPXXQPLIEKFSANVPRSPVRELLEXEPETAKFSPAE RTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRS LKANQ Description (1)  Endoribonuclease Dicer (E.C.3.1.26.-) Functional site 1) chain A residue 1686-1694 type prosite sequence QRLEFLGDA description RNASE_3_1 Ribonuclease III family signature. QRLEFLGDA source prosite : PS00517 2) chain A residue 1699 type BINDING sequence L description BINDING => ECO:0000250|UniProtKB:Q9UPY3 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 1804 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:Q9UPY3 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 1807 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:Q9UPY3 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 1800 type SITE sequence A description Important for activity => ECO:0000269|PubMed:18268334 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 1862 type MOD_RES sequence V description Phosphoserine => ECO:0000250|UniProtKB:Q9UPY3 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links