eF-site ID 2x04-B PDB Code 2x04 Chain B click to enlarge Title Crystal structure of the PABC-TNRC6C complex Classification PEPTIDE/RNA BINDING PROTEIN Compound POLYADENYLATE-BINDING PROTEIN 1 Source Homo sapiens (Human) (TNR6C_HUMAN) Sequence B:  GPLGSLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAG KITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQ Description Functional site 1) chain B residue 543 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1619 source : AC1 2) chain B residue 548 type sequence S description BINDING SITE FOR RESIDUE SO4 B 1620 source : AC2 3) chain B residue 574 type sequence H description BINDING SITE FOR RESIDUE SO4 B 1620 source : AC2 4) chain B residue 575 type sequence P description BINDING SITE FOR RESIDUE SO4 B 1620 source : AC2 5) chain B residue 576 type sequence T description BINDING SITE FOR RESIDUE SO4 B 1620 source : AC2 6) chain B residue 577 type sequence L description BINDING SITE FOR RESIDUE SO4 B 1620 source : AC2 7) chain B residue 549 type MOD_RES sequence M description Omega-N-methylated arginine; by CARM1; partial => ECO:0000305|PubMed:11850402 source Swiss-Prot : SWS_FT_FI1 8) chain B residue 564 type MOD_RES sequence E description Omega-N-methylarginine => ECO:0000250|UniProtKB:P29341 source Swiss-Prot : SWS_FT_FI2 9) chain B residue 570 type MOD_RES sequence I description Omega-N-methylarginine => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI3 10) chain B residue 595 type MOD_RES sequence H description Omega-N-methylarginine => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI3 11) chain B residue 607 type MOD_RES sequence V description Omega-N-methylarginine => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI3 12) chain B residue 582 type MOD_RES sequence T description Omega-N-methylarginine; alternate => ECO:0000269|Ref.6, ECO:0000269|Ref.7, ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI4 13) chain B residue 601 type MOD_RES sequence E description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links